Conserved Protein Domain Family
Syntaxin

?
pfam00804: Syntaxin 
Syntaxin
Syntaxins are the prototype family of SNARE proteins. They usually consist of three main regions - a C-terminal transmembrane region, a central SNARE domain which is characteristic of and conserved in all syntaxins (pfam05739), and an N-terminal domain that is featured in this entry. This domain varies between syntaxin isoforms; in syntaxin 1A it is found as three alpha-helices with a left-handed twist. It may fold back on the SNARE domain to allow the molecule to adopt a 'closed' configuration that prevents formation of the core fusion complex - it thus has an auto-inhibitory role. The function of syntaxins is determined by their localization. They are involved in neuronal exocytosis, ER-Golgi transport and Golgi-endosome transport, for example. They also interact with other proteins as well as those involved in SNARE complexes. These include vesicle coat proteins, Rab GTPases, and tethering factors.
Statistics
?
PSSM-Id: 334261
View PSSM: pfam00804
Aligned: 71 rows
Threshold Bit Score: 180.405
Threshold Setting Gi: 1133484086
Created: 16-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q84R43        43 KGFFQETEAVEEEMAAIRDALARLNAANEEGKSLHQPDALRaLRGRVNADIIAVLRRARDIRARLEAMDRANAAQRRLSa 122 Japanese rice
Q4S6Z1        44 ENILAKAQSIRKEVSSLRLQVSGLSALTERFGTSVSRLTV--IKRDFDSVARKVQGRGETLYGRLQGLRQESGQLQEKE- 120 spotted green p...
Q6P5J5        49 ESVLDEAQDTRREIQLIRLEVKRLRDQNTRILNEPTRTSY--VKRDANAIAGDIKTRGVDVLARLQKMDAHAKELQEEH- 125 zebrafish
XP_005454701  54 GEIFAQAQGIHKDIQLIRLEVKRLREQNSRMFQATTTMS-T-IKKDSNTIGADIKARAEDVLARLHKMDDMTQKLEETH- 130 Nile tilapia
XP_005802698  53 NNVFSQSQDIHREIQLIRLEVKRLREQNSRMLQGNTTMS-T-IKKDSNAIGADIKKRAEGILDCLHKMDGTAHKLEEEH- 129 southern platyfish
NP_998075     48 EDAFKKAQSIQKEIAQLRMEVKRLGKQNTRFLTSVRRISS--IKRDSNTIARSIKTKGESLYARIQKLDGLCKELEEKQ- 124 zebrafish
XP_003962305  42 DSVLQEAQQVRLEIQAIQNDISELRDVNYQILNKTSFPTV--TKRDSNQIGMDVKRRGEAVLHRLQMMNGLREELEAER- 118 torafugu
CAG13188      42 EAVLQEAQQVRLEIQAIQNDVGELRDVNYQSLNETSFPAV--TKRDSNSIGKEIKVRGEAVLRRLRVMDGRREELEAAR- 118 spotted green p...
XP_003449929  48 EVILKEAESIRKDISLLHLEVARLCAHNERFGISVRRLTL--IKKDCDSIARGIQQRGEALYTRLQVLGKQSKELEEKE- 124 Nile tilapia
XP_003443044  39 DDVLKEAQLIRLEIQQIQNDIRDLKDVNYQALNKTS-DSIV-IKRDSNAIGADIKRRGEAVLQRLHMLNNLRGELEVQR- 115 Nile tilapia
Q84R43       123 gcREGTPLDRTRTALTAALRKKLKDLMLDFQALRQRIMSEYKDTVERRyYTLTGEVPEEEVIERIISEG--R--SEELLC 198 Japanese rice
Q4S6Z1       121 --GPSSAASRIAKAQCDALVHDFNAVMGDYNRAEEMQKIICRGRIKRQ-ASILGTEISDEQLDVVVSDG--GegWTALSH 195 spotted green p...
Q6P5J5       126 --GINSAVARIARTQYATLSNNFQDAMTEYNDAEMNHKESCKRHIQRQ-MEIVGREVSGDQIEEMLENG--E--WNVFND 198 zebrafish
XP_005454701 131 --GTNSAVTRIARTQYACLSNGFRDAMFDYNAAEMSHRESCKAQIQRQ-MEIMGREVTGEEVEEMIEKG--Q--WNIFND 203 Nile tilapia
XP_005802698 130 --GENSAITRIARTQYACLSNGFRDAMFDYNEAEMTHRENCKAQIMRQ-MEIVGRDVSGEDVEEMIEKG--Q--WNIFTD 202 southern platyfish
NP_998075    125 --GAHSALVRMIRGQFISITGAFHEAMNEYNAAEMAQRDNCMTRIQRQ-AEIVGKEVTEDQIEEMIETG--K--WNVFSD 197 zebrafish
XP_003962305 119 --GSADPTARIARTQYQWLSSALQQVMFSYNDAEMSHREACKQQIHRQ-LEVVGKEVTKEELEEMLENG--E--LNVFCP 191 torafugu
CAG13188     119 --GGADPAVRAARCQHRSLSSALRQVMSGYRDAEMSHREACKQQIRRQ-MEVVGEEVTAEDLEEMLEGG--G--WKVFCP 191 spotted green p...
XP_003449929 125 --GANSAVSRIARAQYESLTCAFHSAMTDYSKAEEVQRNTCRVRIQRQ-ASILGKEITDEQLDELVDKGgeG--WAELSQ 199 Nile tilapia
XP_003443044 116 --GSLDPTVRVARTQYHCLSNALREVMFSYNDTEMNHREACKKQIQRQ-MEIVGKEVSMEELEEMMEGE--E--LTVFST 188 Nile tilapia
Q84R43       199 AAVAE-HgKGAvLATVHEIQDRHDAAREVERSLLELHQVFLDMAVVVESQG 248 Japanese rice
Q4S6Z1       196 SLQTV-GgRTS-RWAMNEIKGRHKELVELEARLREVHELFLQMAALVESQG 244 spotted green pufferfish
Q6P5J5       199 NIMSE-G-KTA-RSALNQIEHRHRELLELENRLNSLHEVFLDVAMLVEEQG 246 zebrafish
XP_005454701 204 NIMTE-G-RTA-RSALSQVEKRHQELLDLESRIKSIHEIFLDIAMLVEEQG 251 Nile tilapia
XP_005802698 203 NVVSE-G-KTA-RSALFQIEKRHQELVDLENRIKGIHEIFLDIALLVEEQG 250 southern platyfish
NP_998075    198 DLLTD-G-RTA-RSALTEIENRHKELLELESRIRDIRELFFQLALLVEEQG 245 zebrafish
XP_003962305 192 QV--E-G-KTA-RSALLQIENRHRELLELERRIQGIQELFLDVAVLVEQQG 237 torafugu
CAG13188     192 RL--E-G-RTA-RSALLQIEGRHQELLELEQRIRGIQELFLDVAVLVEQQG 237 spotted green pufferfish
XP_003449929 200 GLQNQsV-RSC-RTALCEIKGRHKDLVELEARMKEIHQLFLQMAILVEEQG 248 Nile tilapia
XP_003443044 189 QI--Q-G-KSA-RSALMQIESRHHELQELEKRIEGIQELFLDVAVLMEEQG 234 Nile tilapia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap