2BSZ,1E2T,2PFR,4BGF,1W4T,3D9W


Conserved Protein Domain Family
Acetyltransf_2

?
pfam00797: Acetyltransf_2 
Click on image for an interactive view with Cn3D
N-acetyltransferase
Arylamine N-acetyltransferase (NAT) is a cytosolic enzyme of approximately 30kDa. It facilitates the transfer of an acetyl group from Acetyl Coenzyme A on to a wide range of arylamine, N-hydroxyarylamines and hydrazines. Acetylation of these compounds generally results in inactivation. NAT is found in many species from Mycobacteria (M. tuberculosis, M. smegmatis etc) to man. It was the first enzyme to be observed to have polymorphic activity amongst human individuals. NAT is responsible for the inactivation of Isoniazid (a drug used to treat Tuberculosis) in humans. The NAT protein has also been shown to be involved in the breakdown of folic acid.
Statistics
?
PSSM-Id: 334258
View PSSM: pfam00797
Aligned: 33 rows
Threshold Bit Score: 232.54
Threshold Setting Gi: 8928292
Created: 14-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2BSZ_A  25 SLDTLKALHFAHPQAIPFENIDPFLG---RPVRLDLAALQDKIVLGGRGGYCFEHNLLFMHALKALGFEVGGLAARVLWG 101 Mesorhizobium loti
O52547  22 DLETLAKLQKSHLMAIPYSSLAYELRdavNVVDLDEDDVFVTSIAEGQGGACYHLNRLFHRLLTELGYDVTPLAGSTAEG 101 Amycolatopsis mediter...
Q5HKP4  21 SLEALNYYVRRFMITVPFENINVQNK---IPISIDIKDLYNKIVIQRRGGFCYELNHLFATYLEHKGFHVTRAAATVHTP 97  Staphylococcus epider...
Q2FUR8  21 sIEALNYYATRFMLTVPFENIDVQNS---KPISINIDALFNKIVHDKRGGFCYELNTFFKAYLQQKGFNPELMSATIHTP 97  Staphylococcus aureus...
Q7T170  20 TLETLRYLHLNHLLTVPFENLTIHTR---GRVRLELPLLYEKIVVNHRGGFCFEINGLFSWLLSQMGYDVTLLSAQIRSR 96  zebrafish
Q82BZ8  22 TVDVLRELQLHHLRTVPFENLSIHLG---EEIVLDEKRLLDKVVGARRGGFCYELNGAFGALLESLGFDVTLLAARVYGE 98  Streptomyces avermitilis
Q9HUY3  25 SLANLDRLIDAHLRRVAFENLDVLLD---RPIEIDADKVFAKVVEGSRGGYCFELNSLFARLLLALGYELELLVARVRWG 101 Pseudomonas aeruginosa
Q87K26  22 DLESLHKIHVAQHRCLPFENFDISLQ---RGISVEIEDIIQKTVYHSRGGYCFELNGLMLDVLKTLGFEARSLLGRVHVM 98  Vibrio parahaemolyticus
Q98AX6  20 TVDGLVALQQAQMRAIPFENIDVLLG---DIPNLTENSIWAKLINARRGGYCFELNKLFGLALEALGFTIQPILCRVRMG 96  Mesorhizobium loti
1W4T_A  45 SLANLDRLIDAHLRRVAFENLDVLLD---RPIEIDADKVFAKVVEGSRGGYCFELNSLFARLLLALGYELELLVARVRWG 121 Pseudomonas aeruginosa
2BSZ_A 102 QSEDa-ITARSHMLLRV-ELDGRTYIADVGFGGL-TLTAPLLLEPGreQKTPHE-PFRIVEA-Dd---HFRLQAAIGGDW 173 Mesorhizobium loti
O52547 102 RETF--GTDVEHMFNLV-TLDGADWLVDVGYPGP-TYVEPLAVSPA--VQTQYGsQFRLVEQeTg---YALQRRGAVTRW 172 Amycolatopsis mediter...
Q5HKP4  98 NGGR--SPEGSHMSLYV-NIEGTLYITDVGFGDLpTSIIEIGSKTQfiPTYDKNgVYCAVWInDn---QYALQKLRQNKW 171 Staphylococcus epider...
Q2FUR8  98 GGGR--SLNGSHASLVV-SINDVFYVTDVGFGDLpLHAIPITSSEHtqPITDISgTFRAIFNnEdk-dIFYVQKFENDHW 173 Staphylococcus aureus...
Q7T170  97 FTGAy-GPPFDHLFLMV-KVDEHRWLCDVGFGSG--FQLPLSLETDspQIQSHG-VYRL-RSeGnlifMESKSEIGGECW 170 zebrafish
Q82BZ8  99 EGRL--GVPYDHLALRVrTVDGGDWLADVGFGAH--SHYPLAFGERgeQVDPGG-TFRVIEAgVdaagARSSGGSAASGD 173 Streptomyces avermitilis
Q9HUY3 102 LPDDapLTQQSHLMLRL-YLAEGEFLVDVGFGSA-NPPRALPLPGDeaDAGQVH-CVRLVDPhAg---LYESAVRGRSGW 175 Pseudomonas aeruginosa
Q87K26  99 GTP----TGRSHQITLV-TLDEQAWIVDVGFGSN-TPRAPLPFILNqvIQTDLQ-TFRFVEDaQfgyfLQVLSTDGTDTW 171 Vibrio parahaemolyticus
Q98AX6  97 AAE---GGPRTHQAFIL-TIEGVDWLADAGFGGP-APIAPLRIDTEelQTAGRD-VFRL--RaDsasgELVVERKNGNEW 168 Mesorhizobium loti
1W4T_A 122 LPDDapLTQQSHLMLRL-YLAEGEFLVDVGFGSA-NPPRALPLPGDeaDAGQVH-CVRLVDPhAg---LYESAVRGRSGW 195 Pseudomonas aeruginosa
2BSZ_A 174 R-------SLYRFDLQPQYEVDYSVTNYFLSTSPTS-HFLSS--VIAARAAPD-RRYALRGNRLSIHh---LGGR--TEQ 237 Mesorhizobium loti
O52547 173 S-------VVYTFTTQPRQWSDWKELEDNFRALVGDtTRTDTqeTLCGRAFAN-GQVFLRQRRYLTV----ENGR--EQV 238 Amycolatopsis mediter...
Q5HKP4 172 M-------TLYEAHLKPQSIKDFKDKISYNEHHPHS-IFVRH--LLITQPQSF-GRATMTYHSLTLS----NDS---TKH 233 Staphylococcus epider...
Q2FUR8 174 H-------TKYEAEFKPKQIEDFNSNIEYNQTHPDS-IFVQH--LLITMPQSF-GRATMSENHLTLT----RNG---SSE 235 Staphylococcus aureus...
Q7T170 171 T-------EQYKFTLEPRDRADFRAMCDYHQSSVSSlMFCKS---LCSLLLPT-GRITIMGRRLIISslgsGDGEhaSRT 239 zebrafish
Q82BZ8 174 LdvlrdgkPQYRLETRPRVLGDFVAGLWWHSTSPKS-HFTQS--LVCSRVTEDgGRITLSGRRFTVTa---ADGR--KEV 245 Streptomyces avermitilis
Q9HUY3 176 L-------PLYRFDLRPQLWIDYIPRNWYTSTHPHS-VFRQG--LKAAITEGD-LRLTLADGLFGQRa---GNGE--TLQ 239 Pseudomonas aeruginosa
Q87K26 172 N-------NLYSFDLEFVFAGDIACGNFFTSTSPNS-RFTSA--RVAAKATES-GLVTLLNYTLKYT----SQGE--QTE 234 Vibrio parahaemolyticus
Q98AX6 169 F-------PLYGFDRATALPSDFEGANFICARWDRS-PFPSS--LMMSVLTAE-GPANLFNKDFSLI----RNQI--EET 231 Mesorhizobium loti
1W4T_A 196 L-------PLYRFDLRPQLWIDYIPRNWYTSTHPHS-VFRQG--LKAAITEGD-LRLTLADGLFGQRa---GNGE--TLQ 259 Pseudomonas aeruginosa
2BSZ_A 238 TEIATAADLadtlqgl-lgiiipDRTA 263 Mesorhizobium loti
O52547 239 RTITDDDEF--------------RALV 251 Amycolatopsis mediterranei S699
Q5HKP4 234 KYDVTTNNYkyflkky---fnlnvsII 257 Staphylococcus epidermidis RP62A
Q2FUR8 236 KFDVTKDNYkhfleky-fglnvtInri 261 Staphylococcus aureus subsp. aureus NCTC 8325
Q7T170 240 ITDLSDEEItellrek-fgivlqAPLI 265 zebrafish
Q82BZ8 246 SDLGTDEEVlgvyrer---fgieldQV 269 Streptomyces avermitilis
Q9HUY3 240 RQLRDVEELldilqtrfrlrldpASEV 266 Pseudomonas aeruginosa
Q87K26 235 LELEPGQAYldalkey-fgieldAQYG 260 Vibrio parahaemolyticus
Q98AX6 232 ETLKTKSELqrvlsdv-frlhlpRSTI 257 Mesorhizobium loti
1W4T_A 260 RQLRDVEELldilqtrfrlrldpasev 286 Pseudomonas aeruginosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap