4Q0W,5FV7


Conserved Protein Domain Family
XPG_N

?
pfam00752: XPG_N 
Click on image for an interactive view with Cn3D
XPG N-terminal domain
Statistics
?
PSSM-Id: 334236
View PSSM: pfam00752
Aligned: 12 rows
Threshold Bit Score: 114.379
Threshold Setting Gi: 1175380
Created: 16-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4Q0W_A    1 GVHSFWDIAGPTA----RPVRLESLED--KRMAVDASIWIYQFLKAVRDQEGNAVKN------SHITGFFRRICKLLYFG 68   Saccharomyces cerev...
P53695    2 GIKGLLGLLKPMQ----KSSHVEEFSG--KTLGVDGYVWLHKAVFTCAHELAFNKETd-----KYLKYAIHQALMLQYYG 70   Schizosaccharomyces...
P39875    2 GIQGLLPQLKPIQ----NPVSLRRYEG--EVLAIDGYAWLHRAACSCAYELAMGKPTd-----KYLQFFIKRFSLLKTFK 70   Saccharomyces cerev...
Q09708    2 GVHGLLPIIRKVAsegiRWLQPEFFSKyyPVLAVDGNLLLYRFFRSPNTPLHTNYQH------VLWALKLSRYCR--KLK 73   Schizosaccharomyces...
P39748    2 GIQGLAKLIADVApsaiRENDIKSYFG--RKVAIDASMSIYQFLIAVR-QGGDVLQNeegettSHLMGMFYRTIRMMENG 78   human
P26793    2 GIKGLNAIISEHVpsaiRKSDIKSFFG--RKVAIDASMSLYQFLIAVRQQDGGQLTNeagettSHLMGMFYRTLRMIDNG 79   Saccharomyces cerev...
P07276    2 GVHSFWDIAGPTA----RPVRLESLED--KRMAVDASIWIYQFLKAVRDQEGNAVKN------SHITGFFRRICKLLYFG 69   Saccharomyces cerev...
P28706    2 GVSGLWDILEPVK----RPVKLETLVN--KRLAIDASIWIYQFLKAVRDKEGNQLKS------SHVVGFFRRICKLLFFG 69   Schizosaccharomyces...
P28715    2 GVQGLWKLLECSG----RQVSPEALEG--KILAVDISIWLNQALKGVRDRHGNSIEN------PHLLTLFHRLCKLLFFR 69   human
P40850    2 AIKSLESFLFERGl--vGSYAIEALNN--CTLDIDVNHYVSRLLTNKREQYLDAIGGfp---tSLKMYLESDLKIFKDFN 74   Saccharomyces cerev...
P39750    2 GIKGLAQVLSEHApasvKHNDIKNYFG--RKVAIDASMSLYQFLIQVRSQDGQQLMNeqgettSHLMGMFYRTLRIVDNG 79   Schizosaccharomyces...
5FV7_A    2 GIQGLAKLIADVApsaiRENDIKSYFG--RKVAIDASMSIYQFLIAVR-QGGDVLQNeegettSHLMGMFYRTIRMMENG 78   human
4Q0W_A   69 IRPVFVFDGGVP-VLKRETIRQRKERRQGK 97   Saccharomyces cerevisiae S288c
P53695   71 VKPLIVFDGGPL-PCKASTEQKRKERRQEA 99   Schizosaccharomyces pombe 972h-
P39875   71 VEPYLVFDGDAI-PVKKSTESKRRDKRKEN 99   Saccharomyces cerevisiae S288c
Q09708   74 TSPIVVFDNLKPnDFKAEEHEKRSLISSQI 103  Schizosaccharomyces pombe 972h-
P39748   79 IKPVYVFDGKPP-QLKSGELAKRSERRAEA 107  human
P26793   80 IKPCYVFDGKPP-DLKSHELTKRSSRRVET 108  Saccharomyces cerevisiae S288c
P07276   70 IRPVFVFDGGVP-VLKRETIRQRKERRQGK 98   Saccharomyces cerevisiae S288c
P28706   70 IKPVFVFDGGAP-SLKRQTIQKRQARRLDR 98   Schizosaccharomyces pombe 972h-
P28715   70 IRPIFVFDGDAP-LLKKQTLVKRRQRKDLA 98   human
P40850   75 ITPIFVFNGGLT-YNQLEASGHFTAASASA 103  Saccharomyces cerevisiae S288c
P39750   80 IKPCFVFDGKPP-TLKSGELAKRVARHQKA 108  Schizosaccharomyces pombe 972h-
5FV7_A   79 IKPVYVFDGKPP-QLKSGELAKRSERRAEa 107  human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap