1UL1,4Q0Z


Conserved Protein Domain Family
XPG_N

?
pfam00752: XPG_N 
Click on image for an interactive view with Cn3D
XPG N-terminal domain
Statistics
?
PSSM-Id: 395609
View PSSM: pfam00752
Aligned: 10 rows
Threshold Bit Score: 115.151
Threshold Setting Gi: 1175380
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1UL1_Z    1 GIQGLAKLIADVApsaiRENDIKSYFG--RKVAIDASMSIYQFLIAVR-QGGDVLQNeegetTSHLMGMFYRTIRMMENG 77   human
P53695    2 GIKGLLGLLKPMQ----KSSHVEEFSG--KTLGVDGYVWLHKAVFTCAhELAFNKET-----DKYLKYAIHQALMLQYYG 70   Schizosaccharomyces...
P39875    2 GIQGLLPQLKPIQ----NPVSLRRYEG--EVLAIDGYAWLHRAACSCAyELAMGKPT-----DKYLQFFIKRFSLLKTFK 70   Saccharomyces cerev...
Q09708    2 GVHGLLPIIRKVAsegiRWLQPEFFSKyyPVLAVDGNLLLYRFFRSPNtPLHTNYQH------VLWALKLSRYCR--KLK 73   Schizosaccharomyces...
P39750    2 GIKGLAQVLSEHApasvKHNDIKNYFG--RKVAIDASMSLYQFLIQVRsQDGQQLMNeqgetTSHLMGMFYRTLRIVDNG 79   Schizosaccharomyces...
P26793    2 GIKGLNAIISEHVpsaiRKSDIKSFFG--RKVAIDASMSLYQFLIAVRqQDGGQLTNeagetTSHLMGMFYRTLRMIDNG 79   Saccharomyces cerev...
4Q0Z_B    1 GVHSFWDIAGPTA----RPVRLESLED--KRMAVDASIWIYQFLKAVRdQEGNAVKN------SHITGFFRRICKLLYFG 68   Saccharomyces cerev...
P28706    2 GVSGLWDILEPVK----RPVKLETLVN--KRLAIDASIWIYQFLKAVRdKEGNQLKS------SHVVGFFRRICKLLFFG 69   Schizosaccharomyces...
P28715    2 GVQGLWKLLECSG----RQVSPEALEG--KILAVDISIWLNQALKGVRdRHGNSIEN------PHLLTLFHRLCKLLFFR 69   human
P40850    2 AIKSLESFLFERGl--vGSYAIEALNN--CTLDIDVNHYVSRLLTNKReQYLDAIGGf---pTSLKMYLESDLKIFKDFN 74   Saccharomyces cerev...
1UL1_Z   78 IKPVYVFDGKPP-QLKSGELAKRSERRAEA 106  human
P53695   71 VKPLIVFDGGPL-PCKASTEQKRKERRQEA 99   Schizosaccharomyces pombe 972h-
P39875   71 VEPYLVFDGDAI-PVKKSTESKRRDKRKEN 99   Saccharomyces cerevisiae S288C
Q09708   74 TSPIVVFDNLKPnDFKAEEHEKRSLISSQI 103  Schizosaccharomyces pombe 972h-
P39750   80 IKPCFVFDGKPP-TLKSGELAKRVARHQKA 108  Schizosaccharomyces pombe 972h-
P26793   80 IKPCYVFDGKPP-DLKSHELTKRSSRRVET 108  Saccharomyces cerevisiae S288C
4Q0Z_B   69 IRPVFVFDGGVP-VLKRETIRQRKERRQGK 97   Saccharomyces cerevisiae S288C
P28706   70 IKPVFVFDGGAP-SLKRQTIQKRQARRLDR 98   Schizosaccharomyces pombe 972h-
P28715   70 IRPIFVFDGDAP-LLKKQTLVKRRQRKDLA 98   human
P40850   75 ITPIFVFNGGLT-YNQLEASGHFTAASASA 103  Saccharomyces cerevisiae S288C
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap