4OBY,4Q2X


Conserved Protein Domain Family
tRNA-synt_1d

?
pfam00750: tRNA-synt_1d 
Click on image for an interactive view with Cn3D
tRNA synthetases class I (R)
Other tRNA synthetase sub-families are too dissimilar to be included. This family includes only arginyl tRNA synthetase.
Statistics
?
PSSM-Id: 279136
View PSSM: pfam00750
Aligned: 4 rows
Threshold Bit Score: 529.833
Threshold Setting Gi: 308153546
Created: 13-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4OBY_A  96 HVQQALASDRLg--VATPEKQTIVVDYSAPNVAKEMHVGHLRSTIIGDAAVRTLEFLGHKVIRANHVGDWGTQFGMLIAW 173 Escherichia coli K-12
P43832  95 EISAALSHKNLg--IQATNKQTVVIDYSSPNVAKEMHVGHLRSTIIGDAVARTLEFLGHNVIRANHVGDWGTQFGMLIAY 172 Haemophilus influenza...
P38714 159 TVPNILLQKGKygqKKSRHQKKVVVEFSSPNIAKPFHAGHLRSTIIGGFLSNLYEAMGWSVTRMNYLGDWGRQFGLLAVG 238 Saccharomyces cerevis...
4Q2X_A 121 QLTSLLVNGVQl--PALGENKKVIVDFSSPNIAKEMHVGHLRSTIIGESISRLFEFAGYDVLRLNHVGDWGTQFGMLIAH 198 human
4OBY_A 174 LEKQQQEN-AgEMELADLEGFYRDAKKHYDEDEE-------FAERARNYVVKLQSGDEY----FREMWRK-LVDITMTQN 240 Escherichia coli K-12
P43832 173 LEKMQNEHaS-EMELQDLEAFYREAKKHYDEDEV-------FAEKARNYVVKLQSGDEY----CRTMWKR-LVDITMQQN 239 Haemophilus influenza...
P38714 239 FKRYGDEKtLqKQPIQHLFDVYVKINMDLAKEEIngnskcgISGEARSFFKNLENGDENaikiWNRFRSLsIHHYIQT-Y 317 Saccharomyces cerevis...
4Q2X_A 199 LQDKFPDYlTvSPPIGDLQVFYKESKKRFDTEEE-------FKKRAYQCVVLLQGKNPD----ITKAWKL-ICDVSRQEL 266 human
4OBY_A 241 QITYDRLNVTLTRddvMGES-LYNPMLPGIVADLKAKGLAVESEGATVVFLDEFknkeGEPMGV-IIQKKDGGYLYTTTD 318 Escherichia coli K-12
P43832 240 QHNYARLNVTLTEkdvMGES-LYNPMLPSIVKDLKKQGLAVENDGALVVYLDEFknkdGDPMGV-IVQKKDGGFLYTTTD 317 Haemophilus influenza...
P38714 318 SRLNINFDIFS------GESqVSKESMNEALDIFRKNNLVKEIDGALVIDLTQW----SKRLGRvVVQKSDGTTLYLTRD 387 Saccharomyces cerevis...
4Q2X_A 267 NKIYDALDVSLIE---RGES-FYQDRMNDIVKEFEDRGFVQVDDGRKIVFVP------GCSIPL-TIVKSDGGYTYDTSD 335 human
4OBY_A 319 IACAKYRYETLHADRVLYYIDSRQHQHLMQAWAIVRKAG-YVPE-SVPLEHHMFGMMLGKDGKPFKTRAGGTVKLADLLD 396 Escherichia coli K-12
P43832 318 IAAAKYRYETLKANRALVFSDTRQSQHMQQAWLITRKAG-YVPD-SFSLEHKNFGMMLGKDGKPFKTRTGGTVKLADLLD 395 Haemophilus influenza...
P38714 388 VGAAIERKKNLHFDKMVYVISSQQDLYMSQFFMILKKMN-F--EwAKDLQHINFGMVq-----GMSTRKGNVVFLDTILD 459 Saccharomyces cerevis...
4Q2X_A 336 LAAIKQRLFEEKADMIIYVVDNGQSVHFQTIFAAAQMIGwYDPK-VTRVFHAGFGVVLGEDKKKFKTRSGETVRLMDLLG 414 human
4OBY_A 397 EALERARRLVAEKNPD--MPADELEKLANAVGIGAVKYADLSKNRTTDYIFDW 447 Escherichia coli K-12
P43832 396 EAIERATVLINEKNTN--LSNDEKEAVIEAVGIGAVKYADLSKNRTTDYVFDW 446 Haemophilus influenzae Rd KW20
P38714 460 EARDKALQ-IMENNKMkiSQVDNPQRVADLIGVSAIIIQDMKSKRINNYEFNW 511 Saccharomyces cerevisiae S288c
4Q2X_A 415 EGLKRSMDKLKEKERDkvLTAEELNAAQTSVAYGCIKYADLSRNRLNDYIFSF 467 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap