4OBY,4Q2X


Conserved Protein Domain Family
tRNA-synt_1d

?
pfam00750: tRNA-synt_1d 
Click on image for an interactive view with Cn3D
tRNA synthetases class I (R)
Other tRNA synthetase sub-families are too dissimilar to be included. This family includes only arginyl tRNA synthetase.
Statistics
?
PSSM-Id: 279136
View PSSM: pfam00750
Aligned: 4 rows
Threshold Bit Score: 529.833
Threshold Setting Gi: 308153546
Created: 13-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4OBY_A        96 HVQQALASDRLg--VATPEKQTIVVDYSAPNVAKEMHVGHLRSTIIGDAAVRTLEFLGHKVIRANHVGDWGTQFGMLIAW 173
gi 1174541    95 EISAALSHKNLg--IQATNKQTVVIDYSSPNVAKEMHVGHLRSTIIGDAVARTLEFLGHNVIRANHVGDWGTQFGMLIAY 172
gi 308153546 159 TVPNILLQKGKygqKKSRHQKKVVVEFSSPNIAKPFHAGHLRSTIIGGFLSNLYEAMGWSVTRMNYLGDWGRQFGLLAVG 238
4Q2X_A       121 QLTSLLVNGVQl--PALGENKKVIVDFSSPNIAKEMHVGHLRSTIIGESISRLFEFAGYDVLRLNHVGDWGTQFGMLIAH 198
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4OBY_A       174 LEKQQQEN-AgEMELADLEGFYRDAKKHYDEDEE-------FAERARNYVVKLQSGDEY----FREMWRK-LVDITMTQN 240
gi 1174541   173 LEKMQNEHaS-EMELQDLEAFYREAKKHYDEDEV-------FAEKARNYVVKLQSGDEY----CRTMWKR-LVDITMQQN 239
gi 308153546 239 FKRYGDEKtLqKQPIQHLFDVYVKINMDLAKEEIngnskcgISGEARSFFKNLENGDENaikiWNRFRSLsIHHYIQT-Y 317
4Q2X_A       199 LQDKFPDYlTvSPPIGDLQVFYKESKKRFDTEEE-------FKKRAYQCVVLLQGKNPD----ITKAWKL-ICDVSRQEL 266
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4OBY_A       241 QITYDRLNVTLTRddvMGES-LYNPMLPGIVADLKAKGLAVESEGATVVFLDEFknkeGEPMGV-IIQKKDGGYLYTTTD 318
gi 1174541   240 QHNYARLNVTLTEkdvMGES-LYNPMLPSIVKDLKKQGLAVENDGALVVYLDEFknkdGDPMGV-IVQKKDGGFLYTTTD 317
gi 308153546 318 SRLNINFDIFS------GESqVSKESMNEALDIFRKNNLVKEIDGALVIDLTQW----SKRLGRvVVQKSDGTTLYLTRD 387
4Q2X_A       267 NKIYDALDVSLIE---RGES-FYQDRMNDIVKEFEDRGFVQVDDGRKIVFVP------GCSIPL-TIVKSDGGYTYDTSD 335
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4OBY_A       319 IACAKYRYETLHADRVLYYIDSRQHQHLMQAWAIVRKAG-YVPE-SVPLEHHMFGMMLGKDGKPFKTRAGGTVKLADLLD 396
gi 1174541   318 IAAAKYRYETLKANRALVFSDTRQSQHMQQAWLITRKAG-YVPD-SFSLEHKNFGMMLGKDGKPFKTRTGGTVKLADLLD 395
gi 308153546 388 VGAAIERKKNLHFDKMVYVISSQQDLYMSQFFMILKKMN-F--EwAKDLQHINFGMVq-----GMSTRKGNVVFLDTILD 459
4Q2X_A       336 LAAIKQRLFEEKADMIIYVVDNGQSVHFQTIFAAAQMIGwYDPK-VTRVFHAGFGVVLGEDKKKFKTRSGETVRLMDLLG 414
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|...
4OBY_A       397 EALERARRLVAEKNPD--MPADELEKLANAVGIGAVKYADLSKNRTTDYIFDW 447
gi 1174541   396 EAIERATVLINEKNTN--LSNDEKEAVIEAVGIGAVKYADLSKNRTTDYVFDW 446
gi 308153546 460 EARDKALQ-IMENNKMkiSQVDNPQRVADLIGVSAIIIQDMKSKRINNYEFNW 511
4Q2X_A       415 EGLKRSMDKLKEKERDkvLTAEELNAAQTSVAYGCIKYADLSRNRLNDYIFSF 467
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap