5AR1,3FTQ


Conserved Protein Domain Family
Septin

?
pfam00735: Septin 
Click on image for an interactive view with Cn3D
Septin
Members of this family include CDC3, CDC10, CDC11 and CDC12/Septin. Members of this family bind GTP. As regards the septins, these are polypeptides of 30-65kDa with three characteristic GTPase motifs (G-1, G-3 and G-4) that are similar to those of the Ras family. The G-4 motif is strictly conserved with a unique septin consensus of AKAD. Most septins are thought to have at least one coiled-coil region, which in some cases is necessary for intermolecular interactions that allow septins to polymerize to form rod-shaped complexes. In turn, these are arranged into tandem arrays to form filaments. They are multifunctional proteins, with roles in cytokinesis, sporulation, germ cell development, exocytosis and apoptosis.
Statistics
?
PSSM-Id: 307057
View PSSM: pfam00735
Aligned: 14 rows
Threshold Bit Score: 385.11
Threshold Setting Gi: 3123278
Created: 13-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5AR1_A  25 GITFTVMIVGQSGSGRSTFINTLCGQQVVDTStTILLPTDtSTEIDLQLR-EETVELEDDeGVKIQLNIIDTPGFGDSLD 103 baker's yeast
P39827  35 GFQFNIMVVGRSGLGKSTLVNTLFSSKLTTSQ-GRKSPSE-PIEKTTEIK-VASHSLLEN-NVRLNINVIDTPGFGDQIN 110 Candida albicans SC5314
P32468  32 GGTFTVMLCGESGLGKTTFINTLFQTVLKRADg-QQHRQE-PIRKTVEID-ITRALLEEK-HFELRVNVIDTPGFGDNVN 107 Saccharomyces cerevis...
P41901 107 GIDFTLMVAGQSGLGKTTFINSLFSTSLIDD----------DIKENKPII-RYKSIVEGD-GTHLNFNVIDTPGFGNNMD 174 Saccharomyces cerevis...
Q09883  28 ECGLTIMLCGASGTGKTTFFNTLFATSLQPEk-SYETAKEtIAKKTLEVK-KNKAVIEED-GFHINLTVLDTPGFGDFID 104 Schizosaccharomyces p...
P40797 140 GFEFTLMVVGASGLGKSTLINSMFLSDIYNAe-QYPGPSL-RKKKTVAVE-ATKVMLKEN-GVNLTLTVVDTPGFGDAVD 215 fruit fly
P42209  23 GFDFTLMVAGESGLGKSTLINSLFLTNLYEDr-QVPDASA-RTAQTLTIE-RRGVEIEEG-GIKVKLTLVDTPGFGDSVD 98  house mouse
P28661 142 GFDFTLMVAGESGLGKSTLVNSLFLTDLYRDr-KLLGAEE-RIMQTVEIT-KHAVDIEEK-GVRLRLTIVDTPGFGDAVN 217 house mouse
P48008  50 GIPLNLMVVGDVGLGRTAFINTLCEKPLIRHNnNFD-PAEaSSVSPVEIVpYQTDIILED-GTKINLTVLDTPHFGEAID 127 Schizosaccharomyces p...
P48010 116 GIDINLIVVGESSLGKTTFVNSFLQSNDTNFR-----P---KK--TMDFVeHKATLSDGD--QKFNLTIVDTPGFGDKSD 183 Schizosaccharomyces p...
5AR1_A 104 NSPSFEIISDYIRHQYDEILLEESRVRRnPRFKDGRVHCCLYLINPTGHGLKEIDVEFIRQLGSLVNIIPVISKSDSLTR 183 baker's yeast
P39827 111 NEKCWEPLVKYVKEQHSQYLRKELTAQRdKFLADTRVHCILYFIPPNGQKLKQLDVQALKKLSEIANVVPIIAKSDSLTL 190 Candida albicans SC5314
P32468 108 NNKAWQPLVDFIDDQHDSYMRQEQQPYR-TKKFDLRVHAVLYFIRPTGHGLKPIDIETMKRLSTRANLIPVIAKADTLTA 186 Saccharomyces cerevis...
P41901 175 NAFTWRTMVNYIDEEIRSYIFQEEQPDR-TKMVDNRVHCCLYFLRPSNKGIDTLDVVTMKKLAKRVNLIPVIAKSDLLTK 253 Saccharomyces cerevis...
Q09883 105 NTSCWNTVAEYLDEQHERYLIHDQNSLR-VPRKDTRVHVCLYFITPVSFGMLPLDVLAMKELSTHVNLVPVIAKADTFTT 183 Schizosaccharomyces p...
P40797 216 NSNCWVPILEYVDSKYEEYLTAESRVYR-KTISDSRVHCCLYFIAPSGHGLLPLDIACMQSLSDKVNLVPVIAKADTMTP 294 fruit fly
P42209  99 CSDCWLPVVRFIEEQFEQYLRDESGLNR-KNIQDSRVHCCLYFISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADALMP 177 house mouse
P28661 218 NTECWKPVAEYIDQQFEQYFRDESGLNR-KNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTP 296 house mouse
P48008 128 NENNFDIILQYIESQYDNVLEEESRIKRnARFCDDRVHALIYFISPTGHGLRELDIELMRRLAPRVNIIPAIAKADSLTA 207 Schizosaccharomyces p...
P48010 184 NSNCWRPIATNLLHRLNAYFQNEVKMDReTSEIDSRIHGCLFFINPNGHRLQPLEIYIMKKIDQFVNIIPVIGKADTMTS 263 Schizosaccharomyces p...
5AR1_A 184 DELKLNKKLIMEDIDRWNLPIYNfpFDEDEIS----------DED-YETNMYLRTLLPFAIIGSNEVYEMggDVGTIRGR 252 baker's yeast
P39827 191 DERSEFKKLLQSEFMKYNFNIYP--YDSEDLY----------EEE-RQLNEDIKSLIPFAIAGSETEIEI--NGEMVRGR 255 Candida albicans SC5314
P32468 187 QELQQFKSRIRQVIEAQEIRIFT--PPLDADSkedaksgsnpDSAaVEHARQLIEAMPFAIVGSEKKFDNg-QGTQVVAR 263 Saccharomyces cerevis...
P41901 254 EELKNFKTQVREIIRVQDIPVCFf-FGDEVLN----------------ATQDIFQKYPFSIIASNEYIFNe-KGEKVKGR 315 Saccharomyces cerevis...
Q09883 184 PELTQIKQKIRRILEAQSIDVFH--PSTEYSD-----------YE---TAELLDSSLPYAIISSVNEVCKd-DGEKSQGR 246 Schizosaccharomyces p...
P40797 295 DEVHLFKKQILNEIAQHKIKIYDf-PATLEDA----------AEE-AKTTQNLRSRVPFAVVGANTIIEQ--DGKKVRGR 360 fruit fly
P42209 178 RETQALKQKIRDQLKEEEINIYQf-PECDSDE----------DEEfKKQNEEMKENIPFAVVGSCEVVRD--GTRPVRGR 244 house mouse
P28661 297 PEVDRKKCKIREEIEHFGIKIYQf-PDCDSDE----------DEDfKLQDQALKESIPFAVIGSNTVVEA--RGRRVRGR 363 house mouse
P48008 208 QELQTTKEMINADIEYYKIPVYDfpYDIEEDE-----------EAiINLSQQLRATIPFAIVSSDRLIEM--NGQTVRGR 274 Schizosaccharomyces p...
P48010 264 DELNHFKKRVIADMVREKIRYFR----EPHNE------------------KKAKIPIPFAIVGAGAPIEH--DGKCIRGR 319 Schizosaccharomyces p...
5AR1_A 253 KYPWGILDVEDSSISDFVILRNALLISHLHDLKNYTHEILYERYRTEALSG 303 baker's yeast
P39827 256 KTKWGAINIEDVSQCEFVFLRDFLTRTHLQDLIETTALTHYETFRSKQLIA 306 Candida albicans SC5314
P32468 264 KYPWGLVEIENDSHCDFRKLRALLLRTYLLDLISTTQEMHYETYRRLRLEG 314 Saccharomyces cerevisiae S288c
P41901 316 QYKWGAVDIENEKYCDFKILQKTIFDWNLIDLVESTED-YYEKCRSEMLRT 365 Saccharomyces cerevisiae S288c
Q09883 247 RYPWGTSEIYEETHCDFLKLKKLLINRHMLELINTTETNIYERYRREQLTN 297 Schizosaccharomyces pombe 972h-
P40797 361 RYPWGLVEVENLTHCDFIALRNMVIRTHLQDLKDVTNNVHYENYRCRKLSE 411 fruit fly
P42209 245 RYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARCLQS 295 house mouse
P28661 364 LYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQS 414 house mouse
P48008 275 AYPWGVVEVDNPRHSDFLALRSALFATHIEDLHNITSNQLYETYRTEKLST 325 Schizosaccharomyces pombe 972h-
P48010 320 AYPWGLVDIDDPKQSDFCQLRNFLLYTHIEGLKHKTHKLIYDTFRTEKLVA 370 Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap