4WAP,3QOY


Conserved Protein Domain Family
Ribosomal_L1

?
pfam00687: Ribosomal_L1 
Click on image for an interactive view with Cn3D
Ribosomal protein L1p/L10e family
This family includes prokaryotic L1 and eukaryotic L10.
Statistics
?
PSSM-Id: 334211
View PSSM: pfam00687
Aligned: 673 rows
Threshold Bit Score: 60.9744
Threshold Setting Gi: 444316668
Created: 14-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4WAP_5        12 VKELA----TAKFDETVEVHAKL-GIDPRRsDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKI 86
gi 124481454   2 LTERK----KRNFKETTELQIQLrDYDVQK-DKRFQGSTRLLHAPYPNIKIGVIGNLTHCDQAKALGLTAIDQDGLKKFN 76
gi 74621235   25 LKESE----DPEKIVTIQIQVNLkGFDPRK-DNKVSKDMVLPYRVRSLDKTIVIADEAHVKVCIDANLPYVPIDEISGDD 99
gi 471221917  17 LTERK----KREFSETIELQIGLrDYDPEK-DKRFSGSIKLPNMPYPNKRVAIIGTMKHCDEAKAANIAYIDVEGLKKFN 91
gi 71660333   17 LTNRK----ERKFKESIDLQVNLkNYDPQK-DKRFSGSVRLPHVCRPRMTVCLLCDLVHEDIAKKNNVPTMNQEELKKLN 91
gi 159483517  16 LVEGAkt-kPRKFQETVELQIGLkNYDPQK-DKRFSGSVRLPFVPRPRMRVCVLGDVKHCEQAGAIGVDAKGVEDLKKLN 93
gi 156088087  16 ILTQSqe-kKRNFVETVELQISLkDYDTQR-DKRFSGTVVLQNVPRERMKICVFGDQVHCDQAKSLGIDYIDLEGLKKFN 93
gi 671407938  17 LKASKe--kKRKFRETVELQVALkNYDPQK-DKRFSGSVRLKNIPRPNMKVCVLGDQQHCDEANANSIPCMNADELKKLN 93
gi 514692555  16 LLKHSlkdkKRKFRETVELQVMLkNYDPSR-DKRFSGTVRLPGIARPGMKVCVLGDDAHCDEAKAADIPCMDVDSLKKLK 94
gi 290972449  17 LTDKN----KRKFVQTVDLQIKLkNYDPSK-DKRFNGSLKLPNYVKKNLKVCILGDHNHCERAKELGIPFKTVDDLKNTN 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4WAP_5        87 l------dGWMDFDAVVATPDVMGAVGSkLGRILGPRGLLPNPK-AgTVGFNIGEIIREIKAgRIEFRn-DKTGAIHAPV 158
gi 124481454  77 kekkpikkWCKPFDILIASESLMKVIPRlVGNVFTKIGKFPIAIpE---TESVSSKVNEVKS-SVKFQl-KNTLSLGTAF 151
gi 74621235  100 kkdi-resVLKKNKFFILCPGYNKIYQ--LKNILRC-GKTPHIL-R--NGDDINAVFETGKK-SCKLRiqDDFSVTSFTV 171
gi 471221917  92 kdkklikkWSKPFDTLICSESLMKQVPRlLGNTLNKIGKFPISItE---GESVVSKVKELQQ-TVKFQl-KKVICLATAV 166
gi 71660333   92 knkklvkkMCNQYDAFLCSESIIKTVPRlVGPHMHRVGKFPTVC-A--MSESLPEKVLEIQS-TVKFQl-KKVLCLGTCV 166
gi 159483517  94 knkklvkkLAQAYHAFLASDSVIKQIPRlLGPGLNKAGKFPAPI-N----KNLEEMVLDTKC-SIKFQl-KKVLCMGVAV 166
gi 156088087  94 rnktlvkkLANKYGAFLASQTLLPQIPRfLGPGLNKAGKFPTQLtH---NDNMEEKVREIKS-SVKFQl-KKVLCMGVAV 168
gi 671407938  94 knkklikkLAKGYDAFLASEALIKQIPRiLGPGLNKAGKFPSVVaH---SEPLITKIEEIRS-TIKFQm-KKVLCLSVAI 168
gi 514692555  95 knkklvkkLAKQYDAFLASSKLLKQLPRiLGPGLNKAGKFPSPVsH---EEKLPEKVDELKA-TVKFQm-KKVLTLGVAI 169
gi 290972449  92 knkkivkkLADSYDAFLASDSLIKRIPRlLGPGLSKAGKFPLVLg--Q-NDDIPAKIEELKK-TVKFQl-KKEINLATAI 166
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*
4WAP_5       159 GKASFPPEKLADNIRAFIRALEAHKPEGakGTFLRSVYVTTTMGP 203
gi 124481454 152 GTDEMSEDQLRQNLSTTINFLVSLLKKG--WQNVGTLHIKTSMGK 194
gi 74621235  172 GHTGMDSEHIYENIKVGMGLLVSYLKNG--SQNLKGVMIKTDQSP 214
gi 471221917 167 GTDKLTEEQIRQNINMSINFLVSLLKKG--WQNIKTLHIKTTMSK 209
gi 71660333  167 GHVEMTEDQVRQNTVMAINFLVSLLKKN--WQNLKSAYIKSTMGK 209
gi 159483517 167 ANVGMTEGEIRTNIMYAINFLVSLLKKN--WQNVRCLYIKSTMGK 209
gi 156088087 169 GNVEMTHEQLRANIVLAINYLVSLLKKN--WHNVRGLTVKSTMGK 211
gi 671407938 169 GHVGMTPEELVSNIALSINFLVSLLKKN--WQNVRSLHIKSTMGP 211
gi 514692555 170 GHVDMSEEELITNSIQAVNFLVSLLKKN--WQNVRSLNIKSTMGP 212
gi 290972449 167 GNVEMPEEEVQQNVTIALNFLVSLLKKN--WQNVGAANIKATMGK 209
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap