2DY1


Conserved Protein Domain Family
EFG_C

?
pfam00679: EFG_C 
Click on image for an interactive view with Cn3D
Elongation factor G C-terminus
This domain includes the carboxyl terminal regions of Elongation factor G, elongation factor 2 and some tetracycline resistance proteins and adopt a ferredoxin-like fold.
Statistics
?
Aligned: 117 rows
Threshold Bit Score: 60.6449
Threshold Setting Gi: 499274162
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2DY1_A          571 LLEPIYRLKVLAPQERVGDVLSDLQARRGRILGMEQE---GALSVVHAEVPLAEVLEYYKALPGLTGGAGAYTLEFSHYA 647 Thermus ther...
Q387N2          439 MCEPYERVTLEFRENLVGDMVSFFSSKMAEIGEITQLs--DGRVCMECLMPVRLLSHVPLRFHTLTAGDGVLNHSFDSYK 516 Trypanosoma ...
Q8NRF1          424 LHEPYEIIVIDVPSEYQGNVTQLLATRKGLMQSMSTTp-gSDWIRMEFRIPARGLIGFRTQFMTETRGTGIANSYSDGMD 502 Corynebacter...
Q3Z6Y9          399 VYEPVETLTIDVREDFVGEVTELLGKRQARMTDMHNDg--EGNVRLEYNIPTRGLIGFRNSFLTATRGTGVLNSQFLDFQ 476 Dehalococcoi...
A0CDU0          437 TLEPMEKVTIEIDQQYMTGLIDKMSQRKAIYEDCINId--KTRVKLIFSAPTRGLVGLRAELINDTRGTAIMQQQFLGYQ 514 Paramecium t...
Q4FPA2          398 RLEPIEEITVDVDEEFSSKIIDSMNRRKGKLLDLKDTg--KDKKRLIFHAPTRGLMGYTSRFLTLTKGTGVINRIFHGYG 475 Candidatus P...
Q5JMX4          462 RLEPIEEVTVEVDEEHVGFVMETLTHRKGEVMDMGPVpgtTGRTRIFLTCPSRGLVGFKGIFSSFTRGTGFMHRAFQAYA 541 Japanese rice
jgi:RoseRS_0100 398 KYEPIEQVELEVAEQYQGAVIELMGQRRGQMRDMSIRd--GGLVHMIFHVPTRGLLGFRQTFLTATRGEGVMNSLFIGYE 475 Roseiflexus ...
Q6F0Z6          401 LLEPMEKVILNIPTEYSGTVINKLNQRKGLMTDMDSD---GVRDKIVYNIPLRALIGFRSEFTNDTHGEGIMVRSSNGFE 477 Mesoplasma f...
Q4N072          425 IVEALQRMIAYVPSEFSAKVVDNVNSRNMEITKYTELegsEKYTKLEFEGSTSQMMGLMPVLRDVTRGRGEFNVTMIGYS 504 Theileria parva
2DY1_A          648 EVPPHLAQR 656 Thermus thermophilus
Q387N2          517 PMTAA--ET 523 Trypanosoma brucei
Q8NRF1          503 VWAGEIKgr 511 Corynebacterium glutamicum
Q3Z6Y9          477 PWCGEIEQs 485 Dehalococcoides mccartyi 195
A0CDU0          515 EYRGVLKKN 523 Paramecium tetraurelia
Q4FPA2          476 KFEGEMDGR 484 Candidatus Pelagibacter ubique HTCC1062
Q5JMX4          542 KYRGQLGNV 550 Japanese rice
jgi:RoseRS_0100 476 PLAGEIVTR 484 Roseiflexus sp. RS-1
Q6F0Z6          478 PYKGEIESR 486 Mesoplasma florum
Q4N072          505 KAGSKIYNA 513 Theileria parva
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap