6CFO,2J9F,1W85,2BP7


Conserved Protein Domain Family
E1_dh

?
pfam00676: E1_dh 
Click on image for an interactive view with Cn3D
Dehydrogenase E1 component
This family uses thiamine pyrophosphate as a cofactor. This family includes pyruvate dehydrogenase, 2-oxoglutarate dehydrogenase and 2-oxoisovalerate dehydrogenase.
Statistics
?
Aligned: 17 rows
Threshold Bit Score: 345.848
Threshold Setting Gi: 254763409
Created: 23-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6CFO_A          41 RMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPT-DHLITAYRAHGFT-FTRGLS-VREILAELTGRK 117  human
P27745          24 RKMRTIRDFEERLHVDFGRGDIPGFVHLYAGEEAAGVGILHHLNDG-DRIASTHRGHGHC-IAKGVD-PVAMMKEIYGKK 100  Cupriavidus ...
P23129         218 EGLDALVPVLDDIIAQSVKSGTTSVNIGMAHRGRLNVLAHVLGKPY-EIIFSEFQHAPNKdLVPSEG-SIGISYGWTGDV 295  Bacillus sub...
ripcm:ACL_1312  41 YKTAVLGRNADIKALQYQRQGRMLTYAPNMGQEAAQIGMAAAMEPQ-DWNSPMYRELNTL-LYRGDK-LENVFLYWYGNE 117  Acholeplasma...
Q5L137          51 MRRMVYTRILDQRSISLNRQGRLGFYAPTAGQEASQIASHFALEKE-DFILPGYRDVPQI-IWHGLP-LYQAFLFSRGHF 127  Geobacillus ...
P37940          20 YRTMLLARKIDERMWLLNRSGKIPFVISCQGQEAAQVGAAFALDREmDYVLPYYRDMGVV-LAFGMTaKDLMMSGFAKAA 98   Bacillus sub...
P11178         116 YKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALDDT-DLVFGQYREAGVL-MYRDYP-LELFMAQCYGNV 192  cattle
Q88EQ2          81 MRAMLKTRIFDSRMVVAQRQKKMSFYMQSLGEEAIGSGQALALNRT-DMCFPTYRQQSIL-MARDVS-LVEMICQLLSNE 157  Pseudomonas ...
2J9F_A          61 YKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALDNT-DLVFGQYREAGVL-MYRDYP-LELFMAQCYGNI 137  human
1W85_A          50 MRRMVYTRILDQRSISLNRQGRLGFYAPTAGQEASQIASHFALEKE-DFILPGYRDVPQI-IWHGLP-LYQAFLFSRGHF 126  Geobacillus ...
6CFO_A         118 ----GGCAKgkggSMH---MyaKn----FYGGNGIVGAQ--VPLGA--GIALACK----------YNGKDEVCLTLYGDG 172  human
P27745         101 ggscNGKGG----SMHi--AdlSk---gMMGANGILGAG--APLIC--GAALAAK----------FRGKGEVGITFCGDG 157  Cupriavidus ...
P23129         296 ----KYHLG----ANRe-lQdaEtksarITLANNPSHLEfiNPIVE--GSTRAAQetrtqsgypvQDETKSLAILIHGDA 364  Bacillus sub...
ripcm:ACL_1312 118 r-----------------gSikPeg-vkILPTNIIIGSQ--SNIAA--GLAMASK----------IRKTNEVTAFTIGDG 165  Acholeplasma...
Q5L137         128 ---------------Hg--NqiPeg-vnVLPPQIIIGAQ--YIQAA--GVALGLK----------MRGKKAVAITYTGDG 175  Geobacillus ...
P37940          99 ----DPNSG----GRQmpgHfgQkk-nrIVTGSSPVTTQ----VPHavGIALAGR----------MEKKDIAAFVTFGEG 155  Bacillus sub...
P11178         193 ----SDLGK----GRQmpvHygCre-rhFVTISSPLATQ----IPQavGAAYAAK----------RANANRVVICYFGEG 249  cattle
Q88EQ2         158 ----RDPLK----GRQlpiMysVre-agFFTISGNLATQ----FVQavGWAMASA----------IKGDTKIASAWIGDG 214  Pseudomonas ...
2J9F_A         138 ----SDLGK----GRQmpvHygCke-rhFVTISSPLATQ--IPQAV--GAAYAAK----------RANANRVVICYFGEG 194  human
1W85_A         127 ----HGNq-------------iPeg-vnVLPPQIIIGAQ--YIQAA--GVALGLK----------MRGKKAVAITYTGDG 174  Geobacillus ...
6CFO_A         173 A-ANQGQIFEAYNMAALWKLPC---IFICENNRYGMGT-SVERAAASTDYYK--RGDFIPGLRVDGMDILCVREATRFAA 245  human
P27745         158 A-SNQGTFLESLNLAAVWNLPV---IFVIENNGYAEST-SRDYGTAVDSYVDraAGFGIPGVTVDGTDFFAVHEAAGEVI 232  Cupriavidus ...
P23129         365 AfPGEGIVAETLNLSSLKGYQVggaIHIIANNMIGFTT-ESAESRSTKYASDlaKGYEIPIVHVNADDPEACLSAVKFAV 443  Bacillus sub...
ripcm:ACL_1312 166 G-TAHGEFYEGLNFAASFKAPV---VAVIQNNQWAIST-PVRKASNSETLAQkgVAFGIPYIQVDGNDMLAMYVASKEAM 240  Acholeplasma...
Q5L137         176 G-TSQGDFYEGINFAGAFKAPA---IFVVQNNRFAIST-PVEKQTIAKTLAQkaVAAGIPGIQVDGMDPLAVYAAVKAAR 250  Geobacillus ...
P37940         156 S-SNQGDFHEGANFAAVHKLPV---IFMCENNKYAISV-PYDKQVACENISDraIGYGMPGVTVNGNDPLEVYQAVKEAR 230  Bacillus sub...
P11178         250 A-ASEGDAHAGFNFAATLECPI---IFFCRNNGYAIST-PTSEQYRGDGIAArgPGYGILSIRVDGNDVFAVYNATKEAR 324  cattle
Q88EQ2         215 A-TAESDFHTALTFAHVYRAPV---ILNVVNNQWAISTfQAIAGGESTTFAGrgVGCGIASLRVDGNDFVAVYAASRWAA 290  Pseudomonas ...
2J9F_A         195 A-ASEGDAHAGFNFAATLECPI---IFFCRNNGYAIST-PTSEQYRGDGIAArgPGYGIMSIRVDGNDVFAVYNATKEAR 269  human
1W85_A         175 G-TSQGDFYEGINFAGAFKAPA---IFVVQNNRFAIST-PVEKQTVAKTLAQkaVAAGIPGIQVDGMDPLAVYAAVKAAR 249  Geobacillus ...
6CFO_A         246 AYCRSGKGPILMELQTYRYHGHSMS-DPGVSYRtREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDA 324  human
P27745         233 RRAREGGGPSLLECKMVRFYGHFEG-D-AQTYRaAGELDDIRANKDCLKLFGRAVTQAGVVAREELDTIDREVAALIEHA 310  Cupriavidus ...
P23129         444 EYRKTFNKDFLIDLIGYRRYGHNEM-DEPSTTQ-PMLYDAVRKHPTVKQIFAEKLVKEGVVTEEVVQNIEKSVTKRIEDA 521  Bacillus sub...
ripcm:ACL_1312 241 DRARKGDGPTLIEAFTYRMGPHTTS-DDPSIYR-TKEEENEWAKKDQIARFKTYLINKGYWSEEEDKKLEEEVLAEINDT 318  Acholeplasma...
Q5L137         251 ERAINGEGPALIETLCFRYGPHTMSgDDPTRYR-SKELENEWAKKDPLVRFRKFLEAKGLWSEEEENRVIEQAKEDIKEA 329  Geobacillus ...
P37940         231 ERARRGEGPTLIETISYRLTPHSSD-DDDSSYRgREEVEEAKKS-DPLLTYQAYLKETGLLSDEIEQTMLDEIMAIVNEA 308  Bacillus sub...
P11178         325 RRAVAENQPFLIEAMTYRIGHHSTS-DDSSAYRsVDEVNYWDKQDHPISRLRHHLQSRGWWDDEQEKAWRKQSRKKVMEA 403  cattle
Q88EQ2         291 ERARRGLGPSLIEWVTYRAGPHSTS-DDPSKYRpADDWSHFPLG-DPIARLKQHLIKIGHWSEEEHQAVTAELEAAVIAA 368  Pseudomonas ...
2J9F_A         270 RRAVAENQPFLIEAMTYRIGHHSTS-DDSSAYRpVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEA 348  human
1W85_A         250 ERAINGEGPTLIETLCFRYGPHTMSgDDPTRYRs-KELENEWAKKDPLVRFRKFLEAKGLWSEEEENNVIEQAKEEIKEA 328  Geobacillus ...
6CFO_A         325 AQFATADPEPPLE 337  human
P27745         311 VQEAKAAPQPGPE 323  Cupriavidus necator H16
P23129         522 YQKVPSKKEHTAC 534  Bacillus subtilis subsp. subtilis str. 168
ripcm:ACL_1312 319 FKKVESYganvel 331  Acholeplasma laidlawii PG-8A
Q5L137         330 IKKADETPKQKVt 342  Geobacillus kaustophilus
P37940         309 TDEAENAPYAAPE 321  Bacillus subtilis subsp. subtilis str. 168
P11178         404 FEQAERKLKPNPS 416  cattle
Q88EQ2         369 QKEAEQYGTLang 381  Pseudomonas putida KT2440
2J9F_A         349 FEQAERKPKPNPn 361  human
1W85_A         329 IKKADETPKQKVt 341  Geobacillus stearothermophilus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap