4M1M,4F4C,4F4C,4M1M,4MYH,3B5W


Conserved Protein Domain Family
ABC_membrane

?
pfam00664: ABC_membrane 
Click on image for an interactive view with Cn3D
ABC transporter transmembrane region
This family represents a unit of six transmembrane helices. Many members of the ABC transporter family (pfam00005) have two such regions.
Statistics
?
PSSM-Id: 307007
View PSSM: pfam00664
Aligned: 71 rows
Threshold Bit Score: 127.761
Threshold Setting Gi: 1170904
Created: 11-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4M1M_A  711 IFCAIINGGLQPAFSVIFSKVVGVFTNG----GPPETq----------------------rQNSNLFSLLFLILGIISFI 764  house mouse
P54719   53 MLMVVISAIFGLLGPFVIGKAIDHFIVG----KTVSG--------------------------LIPVLLLLLAIYIIQSL 102  Bacillus subtilis s...
P45861   20 FFSAIAGGLMELSFPLIVNYFIDTLLPG----RDWGL--------------------------IIATSIGLFAVYALSSA 69   Bacillus subtilis s...
P47260   20 PFFTFAQIVIDLIIPSFLASAISVVFSI----DKLKQdesggktisvdfigganinfanvrEAQIVLATTVILLALCGLF 95   Mycoplasma genitali...
P9WQJ1   21 MMLQLVSTLASLYLPTVNAAIVDDGVAK----GDTAT--------------------------IVRLGAVMLGVTGLQVL 70   Mycobacterium tuber...
P60752   31 GVALILNAASDTFMLSLLKPLLDDGFGK----TDRSV--------------------------LVWMPLVVIGLMILRGI 80   Escherichia coli K-12
P9WQJ3   57 IVPRILGHATDLLFNGVIGRGLPGGITKaqavASARArgdntfadllsg-mnvvpgqgvdfAAVERTLALALALYLAAAL 135  Mycobacterium tuber...
P21441  235 ILPKLLSDVTALMLPVLLEYFVKYLNADn---ATWGW--------------------------GLGLALTIFLTNVIQSC 285  Leishmania tarentolae
P53049  211 IVFAILANCTSGFNPMITKRLIEFVEEK----AIFHS------------------------MHVNKGIGYAIGACLMMFV 262  Saccharomyces cerev...
3B5W_A   31 GVALILNAASDTFMLSLLKPLLDDGF------GKTDR------------------------SVLVWMPLVVIGLMILRGI 80   Escherichia coli
4M1M_A  765 TFFLQGFTF--GK-AGEILTKRLRYMVFKSMLRQDVSWFDDpkNTTGALTTRLANDAAQVKGATGSRLAVIFQNIANLGT 841  house mouse
P54719  103 SLWFQNYWM--IT-ISQGTVFRMRSELFTHLHELPIPFFDK--QRHGELMSRVTNDIENVSSTLNTSVIQILSSVITFVG 177  Bacillus subtilis s...
P45861   70 LQYIVTYWG--HM-LGINIETDMRKSLFDHLQKLSFKFYDN--NKTGTLMSKLTNDLMYIGEVAHHGPEDLFIAVMTILG 144  Bacillus subtilis s...
P47260   96 FGLISIYCA--SY-VSANTSFLLRKKIFAKLMRITTPSHDH--YGSSTLLVRLTNDVYLMEVIAFDFLRLIIRAPLLFIG 170  Mycoplasma genitali...
P9WQJ1   71 CAIGAVYLG--SR-TGAGFGRDLRSAMFEHIITFSERETAR--FGAPTLLTRSTNDVRQILFLVQMTATVLVTAPIMCVG 145  Mycobacterium tuber...
P60752   81 TSYVSSYCI--SW-VSGKVVMTMRRRLFGHMMGMPVSFFDK--QSTGTLLSRITYDSEQVASSSSGALITVVREGASIIG 155  Escherichia coli K-12
P9WQJ3  136 MIWAQARLL--NL-TVQKTMVRLRTDVEDKVHRLPLSYFDG--QQRGELLSRVTNDIDNLQSSLSMTISQLVTSILTMVA 210  Mycobacterium tuber...
P21441  286 SAHKYDHIS--IR-TAALFETSSMALLFEKCFTVSRRSLQRpdMSVGRIMNMVGNDVDNIGSLNWYVMYFWSAPLQLVLC 362  Leishmania tarentolae
P53049  263 NGLTFNHFFhtSQlTGVQAKSILTKAAMKKMFNA--SNYARhcFPNGKVTSFVTTDLARIEFALSFQPFLAGFPAILAIC 340  Saccharomyces cerev...
3B5W_A   81 TSYVSSYCI--SW-VSGKVVMTMRRRLFGHMMGMPVSFFDK--QSTGTLLSRITYDSEQVASSSSGALITVVREGASIIG 155  Escherichia coli
4M1M_A  842 GIIISLIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTREQKFETMYAQSLQ 921  house mouse
P54719  178 TIAVMLYMSPLLTLITLTIIPVMAASLKWITNRTGKLFKEQQKNLGDLNGYIEESVSGAKVIKAYSREKQITAEFLEKNA 257  Bacillus subtilis s...
P45861  145 AFGVMLFINWQLALLTFIIMPIVIWLALYFNKKMTKAFTTLNKDIGDFSARVENNIGGIRLVQAFGNEAFEKERFAVNNQ 224  Bacillus subtilis s...
P47260  171 GLVFAVTTNQDMSISLLITFPLILLVIGILNRKSIPLFKENQKSVDKINERVEEDVSGYKVIQSFNLHSFTNNKFKIANE 250  Mycoplasma genitali...
P9WQJ1  146 GIIMAIHQEAALTWLLLVSVPILAVANYWIISHMLPLFRRMQSLIDGINRVMRDQLSGVRVVRAFTREGYERDKFAQANT 225  Mycobacterium tuber...
P60752  156 LFIMMFYYSWQLSIILIVLAPIVSIAIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSN 235  Escherichia coli K-12
P9WQJ3  211 VLAMMVSISGLLALITLLTVPLSLLVTRAITRRSQPLFVAHWTSTGRLNAHLEETYSGFTVVKTFGHQAAARERFHELND 290  Mycobacterium tuber...
P21441  363 LLLLIRLVGW-LRVPGMAVLFVTLPLQAVISKHVQDVSERMASVVDLRIKRTNELLSGVRIVKFMGWEPVFLARIQDARS 441  Leishmania tarentolae
P53049  341 IVLLIVNLGP-IALVGIGIFFGGFFISLFAFKLILGFRIAANIFTDARVTMMREVLNNIKMIKYYTWEDAYEKNIQDIRT 419  Saccharomyces cerev...
3B5W_A  156 LFIMMFYYSWQLSIILIVLAPIVSIAIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSN 235  Escherichia coli
4M1M_A  922 IPYRNAMKKAHVFGITFSFTQAMMYFSYAAAFRFGAYLVTQ-Q-LMTFEN--VLLVFSAIVFGAM 982  house mouse
P54719  258 ALKTSGFWAQTISGFIPKVMNSLNNLSFTMIAAIGGLFALK-G-WISIGSivVFAEYSRQFTRPL 320  Bacillus subtilis subsp. subtilis ...
P45861  225 RFRVTKLSSYKIMAKNGSISYMLTRFVTLFVLLCGTWFVIR-G-SLSYGEfvAFVLLTNVLFRPI 287  Bacillus subtilis subsp. subtilis ...
P47260  251 GWKKNSTSSLFINSLNIPFTFFLSSLTIIIALLLVFQLDSSvSvDPLPQDaaIRPNIFAFFQYNF 315  Mycoplasma genitalium G37
P9WQJ1  226 ALSNAALSAGNWQALMLPVTTLTINASSVALIWFGGLRIDS-G-QMQVGSliAFLSYFAQILMAV 288  Mycobacterium tuberculosis H37Rv
P60752  236 RMRLQGMKMVSASSISDPIIQLIASLALAFVLYAASFPSVM-D-SLTAGTitVVFSSMIALMRPL 298  Escherichia coli K-12
P9WQJ3  291 DVYQAGFGAQFLSGLVQPATAFIGNLGYVAVAVAGGLQVAT-G-QITLGSiqAFIQYIRQFNMPL 353  Mycobacterium tuberculosis H37Rv
P21441  442 RELRCLRDVHVANVFFMFVNDATPTLVIAVV-FILYHVSGK---VLKPEVvfPTIALLNTMRVSF 502  Leishmania tarentolae
P53049  420 KEISKVRKMQLSRNFLIAMAMSLPSIASLVT-FLAMYKVNK-G-GRQPGNifASLSLFQVLSLQM 481  Saccharomyces cerevisiae S288c
3B5W_A  236 RMRLQGMKMVSASSISDPIIQLIASLALAFVLYAASFPSVM-D-SLTAGTitVVFSSMIALMRPL 298  Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap