4M1M,4F4C,4F4C,4M1M,4MYH,3B5W


Conserved Protein Domain Family
ABC_membrane

?
pfam00664: ABC_membrane 
Click on image for an interactive view with Cn3D
ABC transporter transmembrane region
This family represents a unit of six transmembrane helices. Many members of the ABC transporter family (pfam00005) have two such regions.
Statistics
?
PSSM-Id: 307007
View PSSM: pfam00664
Aligned: 71 rows
Threshold Bit Score: 127.761
Threshold Setting Gi: 1170904
Created: 11-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4M1M_A        711 IFCAIINGGLQPAFSVIFSKVVGVFTNG----GPPETq----------------------rQNSNLFSLLFLILGIISFI 764
gi 1723607     53 MLMVVISAIFGLLGPFVIGKAIDHFIVG----KTVSG--------------------------LIPVLLLLLAIYIIQSL 102
gi 1176951     20 FFSAIAGGLMELSFPLIVNYFIDTLLPG----RDWGL--------------------------IIATSIGLFAVYALSSA 69
gi 1351459     20 PFFTFAQIVIDLIIPSFLASAISVVFSI----DKLKQdesggktisvdfigganinfanvrEAQIVLATTVILLALCGLF 95
gi 618798197   21 MMLQLVSTLASLYLPTVNAAIVDDGVAK----GDTAT--------------------------IVRLGAVMLGVTGLQVL 70
gi 46397619    31 GVALILNAASDTFMLSLLKPLLDDGFGK----TDRSV--------------------------LVWMPLVVIGLMILRGI 80
gi 618798195   57 IVPRILGHATDLLFNGVIGRGLPGGITKaqavASARArgdntfadllsg-mnvvpgqgvdfAAVERTLALALALYLAAAL 135
gi 1170904    235 ILPKLLSDVTALMLPVLLEYFVKYLNADn---ATWGW--------------------------GLGLALTIFLTNVIQSC 285
gi 1730876    211 IVFAILANCTSGFNPMITKRLIEFVEEK----AIFHS------------------------MHVNKGIGYAIGACLMMFV 262
3B5W_A         31 GVALILNAASDTFMLSLLKPLLDDGF------GKTDR------------------------SVLVWMPLVVIGLMILRGI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4M1M_A        765 TFFLQGFTF--GK-AGEILTKRLRYMVFKSMLRQDVSWFDDpkNTTGALTTRLANDAAQVKGATGSRLAVIFQNIANLGT 841
gi 1723607    103 SLWFQNYWM--IT-ISQGTVFRMRSELFTHLHELPIPFFDK--QRHGELMSRVTNDIENVSSTLNTSVIQILSSVITFVG 177
gi 1176951     70 LQYIVTYWG--HM-LGINIETDMRKSLFDHLQKLSFKFYDN--NKTGTLMSKLTNDLMYIGEVAHHGPEDLFIAVMTILG 144
gi 1351459     96 FGLISIYCA--SY-VSANTSFLLRKKIFAKLMRITTPSHDH--YGSSTLLVRLTNDVYLMEVIAFDFLRLIIRAPLLFIG 170
gi 618798197   71 CAIGAVYLG--SR-TGAGFGRDLRSAMFEHIITFSERETAR--FGAPTLLTRSTNDVRQILFLVQMTATVLVTAPIMCVG 145
gi 46397619    81 TSYVSSYCI--SW-VSGKVVMTMRRRLFGHMMGMPVSFFDK--QSTGTLLSRITYDSEQVASSSSGALITVVREGASIIG 155
gi 618798195  136 MIWAQARLL--NL-TVQKTMVRLRTDVEDKVHRLPLSYFDG--QQRGELLSRVTNDIDNLQSSLSMTISQLVTSILTMVA 210
gi 1170904    286 SAHKYDHIS--IR-TAALFETSSMALLFEKCFTVSRRSLQRpdMSVGRIMNMVGNDVDNIGSLNWYVMYFWSAPLQLVLC 362
gi 1730876    263 NGLTFNHFFhtSQlTGVQAKSILTKAAMKKMFNA--SNYARhcFPNGKVTSFVTTDLARIEFALSFQPFLAGFPAILAIC 340
3B5W_A         81 TSYVSSYCI--SW-VSGKVVMTMRRRLFGHMMGMPVSFFDK--QSTGTLLSRITYDSEQVASSSSGALITVVREGASIIG 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4M1M_A        842 GIIISLIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTREQKFETMYAQSLQ 921
gi 1723607    178 TIAVMLYMSPLLTLITLTIIPVMAASLKWITNRTGKLFKEQQKNLGDLNGYIEESVSGAKVIKAYSREKQITAEFLEKNA 257
gi 1176951    145 AFGVMLFINWQLALLTFIIMPIVIWLALYFNKKMTKAFTTLNKDIGDFSARVENNIGGIRLVQAFGNEAFEKERFAVNNQ 224
gi 1351459    171 GLVFAVTTNQDMSISLLITFPLILLVIGILNRKSIPLFKENQKSVDKINERVEEDVSGYKVIQSFNLHSFTNNKFKIANE 250
gi 618798197  146 GIIMAIHQEAALTWLLLVSVPILAVANYWIISHMLPLFRRMQSLIDGINRVMRDQLSGVRVVRAFTREGYERDKFAQANT 225
gi 46397619   156 LFIMMFYYSWQLSIILIVLAPIVSIAIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSN 235
gi 618798195  211 VLAMMVSISGLLALITLLTVPLSLLVTRAITRRSQPLFVAHWTSTGRLNAHLEETYSGFTVVKTFGHQAAARERFHELND 290
gi 1170904    363 LLLLIRLVGW-LRVPGMAVLFVTLPLQAVISKHVQDVSERMASVVDLRIKRTNELLSGVRIVKFMGWEPVFLARIQDARS 441
gi 1730876    341 IVLLIVNLGP-IALVGIGIFFGGFFISLFAFKLILGFRIAANIFTDARVTMMREVLNNIKMIKYYTWEDAYEKNIQDIRT 419
3B5W_A        156 LFIMMFYYSWQLSIILIVLAPIVSIAIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSN 235
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
4M1M_A        922 IPYRNAMKKAHVFGITFSFTQAMMYFSYAAAFRFGAYLVTQ-Q-LMTFEN--VLLVFSAIVFGAM 982
gi 1723607    258 ALKTSGFWAQTISGFIPKVMNSLNNLSFTMIAAIGGLFALK-G-WISIGSivVFAEYSRQFTRPL 320
gi 1176951    225 RFRVTKLSSYKIMAKNGSISYMLTRFVTLFVLLCGTWFVIR-G-SLSYGEfvAFVLLTNVLFRPI 287
gi 1351459    251 GWKKNSTSSLFINSLNIPFTFFLSSLTIIIALLLVFQLDSSvSvDPLPQDaaIRPNIFAFFQYNF 315
gi 618798197  226 ALSNAALSAGNWQALMLPVTTLTINASSVALIWFGGLRIDS-G-QMQVGSliAFLSYFAQILMAV 288
gi 46397619   236 RMRLQGMKMVSASSISDPIIQLIASLALAFVLYAASFPSVM-D-SLTAGTitVVFSSMIALMRPL 298
gi 618798195  291 DVYQAGFGAQFLSGLVQPATAFIGNLGYVAVAVAGGLQVAT-G-QITLGSiqAFIQYIRQFNMPL 353
gi 1170904    442 RELRCLRDVHVANVFFMFVNDATPTLVIAVV-FILYHVSGK---VLKPEVvfPTIALLNTMRVSF 502
gi 1730876    420 KEISKVRKMQLSRNFLIAMAMSLPSIASLVT-FLAMYKVNK-G-GRQPGNifASLSLFQVLSLQM 481
3B5W_A        236 RMRLQGMKMVSASSISDPIIQLIASLALAFVLYAASFPSVM-D-SLTAGTitVVFSSMIALMRPL 298
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap