6QEX,6QEX,4F4C,4F4C,5TTP,5U1D,5UJ9,5UJ9,4MYC,5TWV,5TWV


Conserved Protein Domain Family
ABC_membrane

?
pfam00664: ABC_membrane 
Click on image for an interactive view with Cn3D
ABC transporter transmembrane region
This family represents a unit of six transmembrane helices. Many members of the ABC transporter family (pfam00005) have two such regions.
Statistics
?
Aligned: 81 rows
Threshold Bit Score: 129.292
Threshold Setting Gi: 1170904
Created: 23-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6QEX_A   51 MVVGTLAAIIHGAGLPLMMLVFGEMTDIFANA----GNLEDlmsnitnrsdi---ndtgffmnleEDMTRYAYYYSGIGA 123  human
P54719   49 LILVMLMVVISAIFGLLGPFVIGKAIDHFIVG----KTVSG--------------------------LIPVLLLLLAIYI 98   Bacillus subtilis s...
P45861   16 FFLDFFSAIAGGLMELSFPLIVNYFIDTLLPG----RDWGL--------------------------IIATSIGLFAVYA 65   Bacillus subtilis s...
P47260   16 LILAPFFTFAQIVIDLIIPSFLASAISVVFSI----DKLKQdesggktisvdfigganinfanvrEAQIVLATTVILLAL 91   Mycoplasma genitali...
P9WQJ1   17 VAMLMMLQLVSTLASLYLPTVNAAIVDDGVAK----GDTAT--------------------------IVRLGAVMLGVTG 66   Mycobacterium tuber...
P60752   27 LIVAGVALILNAASDTFMLSLLKPLLDDGFGK----TDRSV--------------------------LVWMPLVVIGLMI 76   Escherichia coli K-12
P21441  231 VWAQILPKLLSDVTALMLPVLLEYFVKYLNADn---ATWGW--------------------------GLGLALTIFLTNV 281  Leishmania tarentolae
P53049  207 YFMSIVFAILANCTSGFNPMITKRLIEFVEEK----AIFHS------------------------MHVNKGIGYAIGACL 258  Saccharomyces cerev...
P9WQJ3   53 TIGVIVPRILGHATDLLFNGVIGRGLPGGITKaqavASARArgdntfadllsg-mnvvpgqgvdfAAVERTLALALALYL 131  Mycobacterium tuber...
5TTP_A   50 LIVAGVALILNAASDTFMLSLLKPLLDDGF------GKTDR------------------------SVLVWMPLVVIGLMI 99   Escherichia coli O1...
6QEX_A  124 GVLVAAYIQVSFW--CL-AAGRQIHKIRKQFFHAIMRQEIGWFDV--HDVGELNTRLTDDVSKINEGIGDKIGMFFQSMA 198  human
P54719   99 IQSLSLWFQNYWM--IT-ISQGTVFRMRSELFTHLHELPIPFFDK--QRHGELMSRVTNDIENVSSTLNTSVIQILSSVI 173  Bacillus subtilis s...
P45861   66 LSSALQYIVTYWG--HM-LGINIETDMRKSLFDHLQKLSFKFYDN--NKTGTLMSKLTNDLMYIGEVAHHGPEDLFIAVM 140  Bacillus subtilis s...
P47260   92 CGLFFGLISIYCA--SY-VSANTSFLLRKKIFAKLMRITTPSHDH--YGSSTLLVRLTNDVYLMEVIAFDFLRLIIRAPL 166  Mycoplasma genitali...
P9WQJ1   67 LQVLCAIGAVYLG--SR-TGAGFGRDLRSAMFEHIITFSERETAR--FGAPTLLTRSTNDVRQILFLVQMTATVLVTAPI 141  Mycobacterium tuber...
P60752   77 LRGITSYVSSYCI--SW-VSGKVVMTMRRRLFGHMMGMPVSFFDK--QSTGTLLSRITYDSEQVASSSSGALITVVREGA 151  Escherichia coli K-12
P21441  282 IQSCSAHKYDHIS--IR-TAALFETSSMALLFEKCFTVSRRSLQRpdMSVGRIMNMVGNDVDNIGSLNWYVMYFWSAPLQ 358  Leishmania tarentolae
P53049  259 MMFVNGLTFNHFFhtSQlTGVQAKSILTKAAMKKMFNA--SNYARhcFPNGKVTSFVTTDLARIEFALSFQPFLAGFPAI 336  Saccharomyces cerev...
P9WQJ3  132 AAALMIWAQARLL--NL-TVQKTMVRLRTDVEDKVHRLPLSYFDG--QQRGELLSRVTNDIDNLQSSLSMTISQLVTSIL 206  Mycobacterium tuber...
5TTP_A  100 LRGITSYVSSYCI--SW-VSGKVVMTMRRRLFGHMMGMPVSFFDK--QSTGTLLSRITYDSEQVASSSSGALITVVREGA 174  Escherichia coli O1...
6QEX_A  199 TFFTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYN 278  human
P54719  174 TFVGTIAVMLYMSPLLTLITLTIIPVMAASLKWITNRTGKLFKEQQKNLGDLNGYIEESVSGAKVIKAYSREKQITAEFL 253  Bacillus subtilis s...
P45861  141 TILGAFGVMLFINWQLALLTFIIMPIVIWLALYFNKKMTKAFTTLNKDIGDFSARVENNIGGIRLVQAFGNEAFEKERFA 220  Bacillus subtilis s...
P47260  167 LFIGGLVFAVTTNQDMSISLLITFPLILLVIGILNRKSIPLFKENQKSVDKINERVEEDVSGYKVIQSFNLHSFTNNKFK 246  Mycoplasma genitali...
P9WQJ1  142 MCVGGIIMAIHQEAALTWLLLVSVPILAVANYWIISHMLPLFRRMQSLIDGINRVMRDQLSGVRVVRAFTREGYERDKFA 221  Mycobacterium tuber...
P60752  152 SIIGLFIMMFYYSWQLSIILIVLAPIVSIAIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFD 231  Escherichia coli K-12
P21441  359 LVLCLLLLIRLVGW-LRVPGMAVLFVTLPLQAVISKHVQDVSERMASVVDLRIKRTNELLSGVRIVKFMGWEPVFLARIQ 437  Leishmania tarentolae
P53049  337 LAICIVLLIVNLGP-IALVGIGIFFGGFFISLFAFKLILGFRIAANIFTDARVTMMREVLNNIKMIKYYTWEDAYEKNIQ 415  Saccharomyces cerev...
P9WQJ3  207 TMVAVLAMMVSISGLLALITLLTVPLSLLVTRAITRRSQPLFVAHWTSTGRLNAHLEETYSGFTVVKTFGHQAAARERFH 286  Mycobacterium tuber...
5TTP_A  175 SIIGLFIMMFYYSWQLSIILIVLAPIVSIAIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFD 254  Escherichia coli O1...
6QEX_A  279 KNLEEAKRIGIKKAITANISIGAAFLLIYASYALAFWYGTTLVLS-G-EYSIGQ--VLTVFFSVLIGAF 343  human
P54719  254 EKNAALKTSGFWAQTISGFIPKVMNSLNNLSFTMIAAIGGLFALK-G-WISIGSivVFAEYSRQFTRPL 320  Bacillus subtilis subsp. subti...
P45861  221 VNNQRFRVTKLSSYKIMAKNGSISYMLTRFVTLFVLLCGTWFVIR-G-SLSYGEfvAFVLLTNVLFRPI 287  Bacillus subtilis subsp. subti...
P47260  247 IANEGWKKNSTSSLFINSLNIPFTFFLSSLTIIIALLLVFQLDSSvSvDPLPQDaaIRPNIFAFFQYNF 315  Mycoplasma genitalium G37
P9WQJ1  222 QANTALSNAALSAGNWQALMLPVTTLTINASSVALIWFGGLRIDS-G-QMQVGSliAFLSYFAQILMAV 288  Mycobacterium tuberculosis H37Rv
P60752  232 KVSNRMRLQGMKMVSASSISDPIIQLIASLALAFVLYAASFPSVM-D-SLTAGTitVVFSSMIALMRPL 298  Escherichia coli K-12
P21441  438 DARSRELRCLRDVHVANVFFMFVNDATPTLVIAVV-FILYHVSGK---VLKPEVvfPTIALLNTMRVSF 502  Leishmania tarentolae
P53049  416 DIRTKEISKVRKMQLSRNFLIAMAMSLPSIASLVT-FLAMYKVNK-G-GRQPGNifASLSLFQVLSLQM 481  Saccharomyces cerevisiae S288C
P9WQJ3  287 ELNDDVYQAGFGAQFLSGLVQPATAFIGNLGYVAVAVAGGLQVAT-G-QITLGSiqAFIQYIRQFNMPL 353  Mycobacterium tuberculosis H37Rv
5TTP_A  255 KVSNRMRLQGMKMVSASSISDPIIQLIASLALAFVLYAASFPSVM-D-SLTAGTitVVFSSMIALMRPL 321  Escherichia coli O157:H7
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap