3L2O,1FS1,4I6J


Conserved Protein Domain Family
F-box

?
pfam00646: F-box 
Click on image for an interactive view with Cn3D
F-box domain
This domain is approximately 50 amino acids long, and is usually found in the N-terminal half of a variety of proteins. Two motifs that are commonly found associated with the F-box domain are the leucine rich repeats (LRRs; pfam00560 and pfam07723) and the WD repeat (pfam00400). The F-box domain has a role in mediating protein-protein interactions in a variety of contexts, such as polyubiquitination, transcription elongation, centromere binding and translational repression.
Statistics
?
PSSM-Id: 334189
View PSSM: pfam00646
Aligned: 435 rows
Threshold Bit Score: 28.7303
Threshold Setting Gi: 74959116
Created: 15-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|
3L2O_B         3 STLTRLPIDVQLYILSFLSPHD--LCQLGSTNHYWNETVRDPILWRYFLL 50
gi 75337355   62 VSIDVLPDECLFEIFRRLSGPQe-RSACAFVSKQWLTLVSSIRQKEIDVP 110
gi 218512038  28 SCLVNLPGEVLEYILCCGSLTAadIGRVSSTCRRLRELCQSSGKVWKEQF 77
gi 75207381   13 TSIIHLPDDCLSFIFQRLDSVAd-HDSFGLTCHRWLNIQNISRRSLQFQC 61
gi 74965100    5 SGFKTMPIELLEDIFQRLPVKN--KGRCSQVCRQWQRGFNSKLSWRKFTF 52
gi 75268079   43 SPFDDLPEDCISNIISFTSPRD--VCVSASVSKSFAHAVQCDSIWEKFLP 90
gi 75274863   32 ASFDDLPDDCLAIISSFTSTPRd-AFLAALVSKSFGLQFNSDSVWEKFLP 80
gi 75268076   12 SPFDSFPEDCISYIISFTNPRD--ACVAATVSKTFESTVKSDIIWEKFLP 59
gi 75268077   34 AELDDLPEECVSIIVSFTSPQD--ACVLASVSKTFASAVKSDIVWEKFIP 81
gi 75268064    6 LISQLLPDHVLHEILLKLATKD--SVKTSILSTRWRYIWQRVPGLDLNQT 53
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap