Conserved Protein Domain Family
CARD

?
pfam00619: CARD 
Click on image for an interactive view with Cn3D
Caspase recruitment domain
Motif contained in proteins involved in apoptotic signaling. Predicted to possess a DEATH (pfam00531) domain-like fold.
Statistics
?
PSSM-Id: 306972
View PSSM: pfam00619
Aligned: 51 rows
Threshold Bit Score: 49.0979
Threshold Setting Gi: 859066256
Created: 14-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2L9M_A        28 LSLIRKNRMALFQQLT--CVLPILDNLLKANVINKQEHDIIKQ-KTQIPLQARELIDT-ILVKGNAAANIFKNCLKEIDS 103
gi 10720034    3 EDKHNKNPLKMLESLGkeLISGLLDDFVEKNVLKLEEEEKKKIyDAKLQDKARVLVDS-IRQKNQEAGQVFVQTFLNIDK 81
gi 341940314   3 ENKHPDKPLKVLEQLGkeVLTEYLEKLVQSNVLKLKEEDKQKFnNAERSDKRWVFVDA-MKKKHSKVGEMLLQTFFSVDP 81
gi 294862523  61 KDNHKKKTVKMLEYLGkdVLHGVFNYLAKHDVLTLKEEEKKKYyDTKIEDKALILVDS-LR-KNRVAHQMFTQTLLNMDQ 138
gi 395398427   4 EKPSNGVLVHMVKLLIktFLDGIFDDLMENNVLNTDEIHLIGKcLKFVVSNAENLVDD-ITETAQTAGKIFREHLWNSKK 82
gi 18203023  117 VNFIDEHWKELIDRVN--NVDPILDILRQKKVITNEDYCTIRN-KETPQKKMRELLTGpITCAGNKGKEVLYDALRESNK 193
4IFP_A       372 LHFVDQYREQLIARVT--SVEVVLDKLHGQ-VLSQEQYERVLA-ENTRPSQMRKLFSL-SQSWDRKCKDGLYQALKETHP 446
gi 17370769  110 GHFVDQHRQALIARVT--EVDGVLDALHGS-VLTEGQYQAVRA-ETTSQDKMRKLFSF-VPSWNLTCKDSLLQALKEIHP 184
2KN6_A       132 LHFIDQHRAALIARVT--NVEWLLDALYGK-VLTDEQYQAVRA-EPTNPSKMRKLFSF-TPAWNWTCKDLLLQALRESQS 206
gi 75057003  112 LHFVDQHRAALIARVT--VVDGVLDALYGK-VLTEEQYQAVRA-ERTSSDKMRKLFSF-SPAWNMTCKDLLLQALRDTQP 186

                 ....*....
2L9M_A       104 TLYKNLFVD 112
gi 10720034   82 NSTSIKAPE 90
gi 341940314  82 GSHHGEANL 90
gi 294862523 139 KITSVKPLL 147
gi 395398427  83 QLSSDISSD 91
gi 18203023  194 FLMDDLEDA 202
4IFP_A       447 HLIMELWEK 455
gi 17370769  185 YLVMDLEQS 193
2KN6_A       207 YLVEDLERS 215
gi 75057003  187 YLVDDLEQS 195
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap