3A31,3IAL,2J3L,2DQ3,3VBB,2EL9,4YYE,1KOG


Conserved Protein Domain Family
tRNA-synt_2b

?
pfam00587: tRNA-synt_2b 
Click on image for an interactive view with Cn3D
tRNA synthetase class II core domain (G, H, P, S and T)
tRNA-synt_2b is a family of largely threonyl-tRNA members.
Statistics
?
PSSM-Id: 278984
View PSSM: pfam00587
Aligned: 8 rows
Threshold Bit Score: 129.839
Threshold Setting Gi: 118138617
Created: 12-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3A31_A  96 YLFD-------IEG--HEFAVKPXNCPYHILLFLNEvAkhRS-KLpLPFKVFEFGRVHRYEP-Sg---SIY-GLLRVRGF 160 Aeropyrum pernix
3IAL_B 103 FWVEkg---glQPLe-ERLALRPTSETAIYSMFSKW-V--RSyKD-LPLKIHQTCTIFRHET-K----NTK-PLIRVREI 168 Giardia lamblia ATCC ...
2J3L_A  94 YRLK-------DRNd-RDYILGPTHEETFTELIRDE-I--NSyKR-LPLNLYQIQTKYRDEK-R-----SRsGLLRGREF 155 Enterococcus faecalis
2DQ3_B 219 YKCE-------RD----NLYLIPTAEVPLTNLYREEiL--KE-EN-LPIYLTAYTPCYRREA-GaygkDIR-GIIRQHQF 281 Aquifex aeolicus VF5
3VBB_A 248 YKVIgkgseksDDNsyDEKYLIATSEQPIAALHRDEwL--RP-ED-LPIKYAGLSTCFRQEVgShg-rDTR-GIFRVHQF 321 human
2EL9_C  75 YTFE-------DRNg-DSLTLRPEGTAGCVRAGIEHgLlyNQ-E----QRLWYIGPMFRHER-P-----QK-G--RYRQF 132 Escherichia coli
4YYE_A 112 FKVEt-----tDEEk-EEYGLKPMNCPGHCLIFGKK-D--RS-YNeLPLRFSDFSPLHRNEA-Sg---ALS-GLTRLRKF 176 Saccharomyces cerevis...
1KOG_B  77 FTTS-------SEN--REYCIKPMNCPGHVQIFN-QgL--KS-YRdLPLRMAEFGSCHRNEP-Sg---SLH-GLMRVRGF 138 Escherichia coli
3A31_A 161 TQDDAHIIVP-G--GRVIDVVYDVFEEXKLVLERLfklG---Vss-----etFKVRLS-----XSDKsligkefxgskee 224 Aeropyrum pernix
3IAL_B 169 HWNEAHCCHAtA--EDAVSQLSDYWKVIDTIFSDE---LcfkG---------QKLRRVc----WDRF------------- 217 Giardia lamblia ATCC ...
2J3L_A 156 IMKDGYSFHAdE--ASLDQSYRDYEKAYSRIFERC---Gl-eF---------RAIIGDgg--aMG--------------- 203 Enterococcus faecalis
2DQ3_B 282 DKVELVKIVH-P--DTSYDELEKLVKDAEEVLQLL---Gl-pY---------RVVELC-----TGDLg------------ 328 Aquifex aeolicus VF5
3VBB_A 322 EKIEQFVYSS-PhdNKSWEMFEEMITTAEEFYQSL---Gi-----------pYHIVNIvsgslNHA-------------- 372 human
2EL9_C 133 HQLGCEVFGL-Q--G--PDIDAELIMLTARWWRAL---Gi-sE---------HVTLEL-----NSIGslearanyrdalv 189 Escherichia coli
4YYE_A 177 HQDDGHIFCT-P--SQVKSEIFNSLKLIDIVYNKI---Fp-fVkggsgaesnY------------FInfstrpdhfigdl 237 Saccharomyces cerevis...
1KOG_B 139 TQDDAHIFCT-E--EQIRDEVNGCIRLVYDMYSTF---Gf-eK---------IVVKLS-----TRPEkrigsdemwdrae 197 Escherichia coli
3A31_A 225 wegaeealr------------------------------------------------eaasrinekygidivelegeaAF 256 Aeropyrum pernix
3IAL_B 218 ------------------------------------------------------------------------------PG 219 Giardia lamblia ATCC ...
2J3L_A     -------------------------------------------------------------------------------- Enterococcus faecalis
2DQ3_B 329 ------------------------------------------------------------------------------FS 330 Aquifex aeolicus VF5
3VBB_A     -------------------------------------------------------------------------------- human
2EL9_C 190 afleqhkekldedckrrmytnplrvldsknpevqallndapalgdyldeesrehfaglckllesagiaytvnqrlvrgLD 269 Escherichia coli
4YYE_A 238 kvwnhaeq--------------------------------------------------vlkeileesgkpwklnpgdgAF 267 Saccharomyces cerevis...
1KOG_B 198 adla---------------------------------------------------------valeennipfeyqlgegAF 220 Escherichia coli
3A31_A 257 YGPKLDFIXXVEes------------------------------------------------------------------ 270 Aeropyrum pernix
3IAL_B 220 ADYSEVSDVVMP-------------------------------------------------------------------- 231 Giardia lamblia ATCC ...
2J3L_A 204 GKDSKEFMAISEigedticystesdyaanlematslytpkkshetqldlekiatpevgtiaevanffevepqriiksvlf 283 Enterococcus faecalis
2DQ3_B 331 AAKTYDIEVWFPs------------------------------------------------------------------- 343 Aquifex aeolicus VF5
3VBB_A 373 ASKKLDLEAWFPg------------------------------------------------------------------- 385 human
2EL9_C 270 YYNRTVFEWVTNs------------------------------------------------------------------- 282 Escherichia coli
4YYE_A 268 YGPKLDIMVTDH-------------------------------------------------------------------- 279 Saccharomyces cerevis...
1KOG_B 221 YGPKIEFTLYDC-------------------------------------------------------------------- 232 Escherichia coli
3A31_A     -------------------------------------------------------------------------------- Aeropyrum pernix
3IAL_B     -------------------------------------------------------------------------------- Giardia lamblia ATCC ...
2J3L_A 284 iadeepvmvlvrgdhdvndvklknflgadfldeateedarrvlgagfgsigpvnvsedvkiyadlavqdlanaivganed 363 Enterococcus faecalis
2DQ3_B     -------------------------------------------------------------------------------- Aquifex aeolicus VF5
3VBB_A     -------------------------------------------------------------------------------- human
2EL9_C     -------------------------------------------------------------------------------- Escherichia coli
4YYE_A     -------------------------------------------------------------------------------- Saccharomyces cerevis...
1KOG_B     -------------------------------------------------------------------------------- Escherichia coli
3A31_A 271 -------------------------------------gVSKEWQXGTIQFD-F-NLPRRFRLy--DVVREEF-GIEEVYI 308 Aeropyrum pernix
3IAL_B 232 --------------------------------------CGRVLQTAGIHNLgQ-RFSSTFDI---LYANKAN-ESVHPYL 268 Giardia lamblia ATCC ...
2J3L_A 364 gyhltnvnpdrdfqpisyedlrfvqegdpspdgngvlaFTKGIEIGHIFKLgT-RYSDAMGA---TVLDENG-REKSVIM 438 Enterococcus faecalis
2DQ3_B 344 --------------------------------------QNKYREISSCSNCeD-FQARRXNT---RFKDSKTgKNRFVHT 381 Aquifex aeolicus VF5
3VBB_A 386 --------------------------------------SGAFRELVSCSNC-TdYQARRLRIrygQTKKMMD-KVEFVHM 425 human
2EL9_C 283 --------------------------------------LGSQG-TVCAGGRyD-GLVEQLGG---RA---------TP-A 309 Escherichia coli
4YYE_A 280 --------------------------------------LRKTHQVATIQLD-F-QLPERFDL---KFKDQDN-SYKRPIM 315 Saccharomyces cerevis...
1KOG_B 233 --------------------------------------LDRAWQCGTVQLD-F-SLPSRLSA---SYVGEDN-ERKVPVM 268 Escherichia coli
3A31_A 309 IHRAlLGsiERFLGVYLEHR 328 Aeropyrum pernix
3IAL_B 269 TCAG-IS--TRVLACALSIH 285 Giardia lamblia ATCC 50803
2J3L_A 439 GCYG-IGv-SRLLSAIVEQN 456 Enterococcus faecalis
2DQ3_B 382 LNGSgLAv-GRTLAAILENY 400 Aquifex aeolicus VF5
3VBB_A 426 LNATmCAt-TRTICAILENY 444 human
2EL9_C 310 VGFA-MGl-ERLVLLVQAVN 327 Escherichia coli
4YYE_A 316 IHRAtFGsiERFMALLIDSN 335 Saccharomyces cerevisiae S288c
1KOG_B 269 IHRAiLGsmERFIGILTEEF 288 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap