2DQ3,4RQE,4HWO,3UGQ,3IAL,3A32


Conserved Protein Domain Family
tRNA-synt_2b

?
pfam00587: tRNA-synt_2b 
Click on image for an interactive view with Cn3D
tRNA synthetase class II core domain (G, H, P, S and T)
tRNA-synt_2b is a family of largely threonyl-tRNA members.
Statistics
?
Aligned: 13 rows
Threshold Bit Score: 132.529
Threshold Setting Gi: 81838863
Created: 14-Mar-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2DQ3_A 219 YKCE-------RDN----LYLIPTAEVPLTNLYREEiL--KE-E-N-LPIYLTAYTPCYRREA-GaygkdIR-GIIRQHQ 280 Aquifex aeolicus VF5
Q831W7  94 YRLK-------DRNdr-dYILGPTHEETFTELIRDE-I--NSyK-R-LPLNLYQIQTKYRDEK-R-----SRsGLLRGRE 154 Enterococcus faecalis...
O66647 219 YKCE-------RDn----LYLIPTAEVPLTNLYREEiL--KE-E-N-LPIYLTAYTPCYRREA-GaygkdIR-GIIRQHQ 280 Aquifex aeolicus VF5
P49591 248 YKVIgkgseksDDNsydeKYLIATSEQPIAALHRDEwL--RP-E-D-LPIKYAGLSTCFRQEVgShg-rdTR-GIFRVHQ 320 human
P60906  68 YTFE-------DRNgd-sLTLRPEGTAGCVRAGIEHgLlyNQ-E-----QRLWYIGPMFRHER-P-----QK-G--RYRQ 124 Escherichia coli K-12
P07236 114 FKVEt-----tDEEke-eYGLKPMNCPGHCLIFGKK-D--RS-Y-NeLPLRFSDFSPLHRNEA-Sg---aLS-GLTRLRK 177 Saccharomyces cerevis...
P0A8M3 318 FTTS-------SENr--eYCIKPMNCPGHVQIFN-QgL--KS-Y-RdLPLRMAEFGSCHRNEP-Sg---sLH-GLMRVRG 378 Escherichia coli K-12
Q9YDW0  96 YLFD-------IEGh--eFAVKPMNCPYHILLFLNEvAkhRS-K-LpLPFKVFEFGRVHRYEP-Sg---sIY-GLLRVRG 159 Aeropyrum pernix K1
4RQE_A 255 sekS-------DDNsydeKYLIATSEQPIAALHRDEwL--RP-E-D-LPIKYAGLSTCFRQEV-GshgrdTR-GIFRVHQ 320 human
4HWO_A  79 FTTS-------SENr--eYCIKPMNCPGHVQIF-NQgL--KS-YrD-LPLRMAEFGSCHRNEP-Sg---sLH-GLMRVRG 139 Escherichia coli K-12
3UGQ_A 112 FKVEt-----tDEEke-eYGLKPMNCPGHCLIFGKK-D--RS-Y-NeLPLRFSDFSPLHRNEA-Sg---aLS-GLTRLRK 175 Saccharomyces cerevis...
3IAL_A 103 FWVEkg---glQPLee-rLALRPTSETAIYSMFSKWvR--SY-K-D-LPLKIHQTCTIFRHETk-----nTK-PLIRVRE 167 Giardia lamblia ATCC ...
3A32_A  96 YLFD-------IEgh--eFAVKPMNCPYHILLFLNEvAkhRS-K-LpLPFKVFEFGRVHRYEP-Sg---sIY-GLLRVRG 159 Aeropyrum pernix K1
2DQ3_A 281 FDKVELVKIV-H-P--DTSYDELEKLVKDAEEVLQLL---Gl-----pY------------------------------- 317 Aquifex aeolicus VF5
Q831W7 155 FIMKDGYSFH-AdE--ASLDQSYRDYEKAYSRIFERC---Gl-----eF------------------------------- 192 Enterococcus faecalis...
O66647 281 FDKVELVKIV-H-P--DTSYDELEKLVKDAEEVLQLL---Gl-----pY------------------------------- 317 Aquifex aeolicus VF5
P49591 321 FEKIEQFVYS-S-PhdNKSWEMFEEMITTAEEFYQSL---Gi-------------------------------------- 357 human
P60906 125 FHQLGCEVFG-L-Q--G--PDIDAELIMLTARWWRAL---Gi-----sE------------------------------- 159 Escherichia coli K-12
P07236 178 FHQDDGHIFC-T-P--SQVKSEIFNSLKLIDIVYNKI---Fp-----fVkggsg-----------------------aes 222 Saccharomyces cerevis...
P0A8M3 379 FTQDDAHIFC-T-E--EQIRDEVNGCIRLVYDMYSTF---Gf-----eK------------------------------- 415 Escherichia coli K-12
Q9YDW0 160 FTQDDAHIIV-P-G--GRVIDVVYDVFEEMKLVLERLfklG-------Vss----------------------------e 200 Aeropyrum pernix K1
4RQE_A 321 FEKIEQFVYS-S-PhdNKSWEMFEEMITTAEEFYQSL---Gi-----pY------------------------------- 359 human
4HWO_A 140 FTQDDAHIFC-T-E--EQIRDEVNGCIRLVYDMYSTF---Gf-----eK------------------------------- 176 Escherichia coli K-12
3UGQ_A 176 FHQDDGHIFC-T-P--SQVKSEIFNSLKLIDIVYNKI---Fp-----fVkggsgaesnyfinfstrpdhfigdlkvwnha 243 Saccharomyces cerevis...
3IAL_A 168 IHWNEAHCCHaT-A--EDAVSQLSDYWKVIDTIFSDE---Lcf----kG------------------------------- 206 Giardia lamblia ATCC ...
3A32_A 160 FTQDDAHIIV-P-G--GRVIDVVYDVFEEMKLVLERL---FklgvsseT------------------------------- 201 Aeropyrum pernix K1
2DQ3_A 318 -RVVELC----------TGdlg---------------------------------------------------------- 328 Aquifex aeolicus VF5
Q831W7 193 -RAIIGDgg-------aMG------------------------------------------------------------- 203 Enterococcus faecalis...
O66647 318 -RVVELC----------TGdlg---------------------------------------------------------- 328 Aquifex aeolicus VF5
P49591 358 pYHIVNIvsg-----slNHa------------------------------------------------------------ 372 human
P60906 160 -HVTLEL----------NSigslearanyrdalvafleqhkekldedckrrmytnplrvldsknpevqallndapalgdy 228 Escherichia coli K-12
P07236 223 nYfinfstrpdhfigdlkvwnhaeq------------------------------------------------------- 247 Saccharomyces cerevis...
P0A8M3 416 -IVVKLS----------TRpekrigsdemwdraeadla------------------------------------------ 442 Escherichia coli K-12
Q9YDW0 201 tFKVRLS----------MSdksligkefmgskeewegaeealr------------------------------------- 233 Aeropyrum pernix K1
4RQE_A 360 -HIVNIV----------SGsln---------------------------------------------------------- 370 human
4HWO_A 177 -IVVKLS----------TRpekrigsdemwdraeadla------------------------------------------ 203 Escherichia coli K-12
3UGQ_A 244 eQVLKEIleesgkpwklNPgdg---------------------------------------------------------- 265 Saccharomyces cerevis...
3IAL_A 207 -QKLRRV----------CWdrf---------------------------------------------------------- 217 Giardia lamblia ATCC ...
3A32_A 202 -FKVRLS----------MSdksligkefmgskeewegaeealr------------------------------------- 233 Aeropyrum pernix K1
2DQ3_A 329 --------------------------------fsAAKTYDIEVWFPS--------------------------------- 343 Aquifex aeolicus VF5
Q831W7 204 ----------------------------------GKDSKEFMAISEIgedticystesdyaanlematslytpkkshetq 249 Enterococcus faecalis...
O66647 329 --------------------------------fsAAKTYDIEVWFPS--------------------------------- 343 Aquifex aeolicus VF5
P49591 373 ----------------------------------ASKKLDLEAWFPG--------------------------------- 385 human
P60906 229 ldeesrehfaglckllesagiaytvnqrlvrgldYYNRTVFEWVTNS--------------------------------- 275 Escherichia coli K-12
P07236 248 ------------vlkeileesgkpwklnpgdgafYGPKLDIMVTDH---------------------------------- 281 Saccharomyces cerevis...
P0A8M3 443 ---------------valeennipfeyqlgegafYGPKIEFTLYDC---------------------------------- 473 Escherichia coli K-12
Q9YDW0 234 -----------eaasrinekygidivelegeaafYGPKLDFIMMVEEs-------------------------------- 270 Aeropyrum pernix K1
4RQE_A 371 --------------------------------haASKKLDLEAWFPG--------------------------------- 385 human
4HWO_A 204 ---------------valeennipfeyqlgegafYGPKIEFTLYDC---------------------------------- 234 Escherichia coli K-12
3UGQ_A 266 --------------------------------afYGPKLDIMVTDH---------------------------------- 279 Saccharomyces cerevis...
3IAL_A 218 --------------------------------pgADYSEVSDVVMP---------------------------------- 231 Giardia lamblia ATCC ...
3A32_A 234 -----------eaasrinekygidivelegeaafYGPKLDFIMMVEE--------------------------------- 269 Aeropyrum pernix K1
2DQ3_A     -------------------------------------------------------------------------------- Aquifex aeolicus VF5
Q831W7 250 ldlekiatpevgtiaevanffevepqriiksvlfiadeepvmvlvrgdhdvndvklknflgadfldeateedarrvlgag 329 Enterococcus faecalis...
O66647     -------------------------------------------------------------------------------- Aquifex aeolicus VF5
P49591     -------------------------------------------------------------------------------- human
P60906     -------------------------------------------------------------------------------- Escherichia coli K-12
P07236     -------------------------------------------------------------------------------- Saccharomyces cerevis...
P0A8M3     -------------------------------------------------------------------------------- Escherichia coli K-12
Q9YDW0     -------------------------------------------------------------------------------- Aeropyrum pernix K1
4RQE_A     -------------------------------------------------------------------------------- human
4HWO_A     -------------------------------------------------------------------------------- Escherichia coli K-12
3UGQ_A     -------------------------------------------------------------------------------- Saccharomyces cerevis...
3IAL_A     -------------------------------------------------------------------------------- Giardia lamblia ATCC ...
3A32_A     -------------------------------------------------------------------------------- Aeropyrum pernix K1
2DQ3_A 344 ------------------------------------------------------------------------QN--KYRE 349 Aquifex aeolicus VF5
Q831W7 330 fgsigpvnvsedvkiyadlavqdlanaivganedgyhltnvnpdrdfqpisyedlrfvqegdpspdgngvlaFT--KGIE 407 Enterococcus faecalis...
O66647 344 ------------------------------------------------------------------------QN--KYRE 349 Aquifex aeolicus VF5
P49591 386 ------------------------------------------------------------------------SG--AFRE 391 human
P60906 276 ------------------------------------------------------------------------LG--SQG- 280 Escherichia coli K-12
P07236 282 ------------------------------------------------------------------------LR--KTHQ 287 Saccharomyces cerevis...
P0A8M3 474 ------------------------------------------------------------------------LD--RAWQ 479 Escherichia coli K-12
Q9YDW0 271 -----------------------------------------------------------------------gVS--KEWQ 277 Aeropyrum pernix K1
4RQE_A 386 ------------------------------------------------------------------------SG--AFRE 391 human
4HWO_A 235 ------------------------------------------------------------------------LD--RAWQ 240 Escherichia coli K-12
3UGQ_A 280 ------------------------------------------------------------------------LR--KTHQ 285 Saccharomyces cerevis...
3IAL_A 232 ------------------------------------------------------------------------CG--RVLQ 237 Giardia lamblia ATCC ...
3A32_A 270 ------------------------------------------------------------------------SGvsKEWQ 277 Aeropyrum pernix K1
2DQ3_A 350 ISSCSNCeD-FQARRXNT---RF---KDSKtG-KNRFVHTLNGSgLAv-GRTLAAILENY 400 Aquifex aeolicus VF5
Q831W7 408 IGHIFKLgT-RYSDAMGA---TV---LDEN-G-REKSVIMGCYG-IGv-SRLLSAIVEQN 456 Enterococcus faecalis V583
O66647 350 ISSCSNCeD-FQARRMNT---RF---KDSK-TgKNRFVHTLNGSgLAv-GRTLAAILENY 400 Aquifex aeolicus VF5
P49591 392 LVSCSNC-TdYQARRLRIrygQT---KKMM-D-KVEFVHMLNATmCAt-TRTICAILENY 444 human
P60906 281 TVCAGGRyD-GLVEQLGG---RA-------------TP-AVGFA-MGl-ERLVLLVQAVN 320 Escherichia coli K-12
P07236 288 VATIQLD-F-QLPERFDL---KF---KDQD-N-SYKRPIMIHRAtFGsiERFMALLIDSN 337 Saccharomyces cerevisiae S288C
P0A8M3 480 CGTVQLD-F-SLPSRLSA---SY---VGED-N-ERKVPVMIHRAiLGsmERFIGILTEEF 529 Escherichia coli K-12
Q9YDW0 278 MGTIQFD-F-NLPRRFRLy--DV---VREE-F-GIEEVYIIHRAlLGsiERFLGVYLEHR 328 Aeropyrum pernix K1
4RQE_A 392 LVSCSNCtD-YQARRLRI---RYgqtKKMM-D-KVEFVHMLNATmCAt-TRTICAILENY 444 human
4HWO_A 241 CGTVQLD-F-SLPSRLSA---SY---VGED-N-ERKVPVMIHRAiLGsmERFIGILTEEF 290 Escherichia coli K-12
3UGQ_A 286 VATIQLD-F-QLPERFDL---KF---KDQD-N-SYKRPIMIHRAtFGsiERFMALLIDSN 335 Saccharomyces cerevisiae S288C
3IAL_A 238 TAGIHNLgQ-RFSSTFDI---LY---ANKA-N-ESVHPYLTCAGi---sTRVLACALSIH 285 Giardia lamblia ATCC 50803
3A32_A 278 MGTIQFD-F-NLPRRFRLy--DV---VREE-F-GIEEVYIIHRAlLGsiERFLGVYLEHR 328 Aeropyrum pernix K1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap