1WUD,2RHF,2CPR,1YT3,2KV2,2DGZ,5C0W


Conserved Protein Domain Family
HRDC

?
pfam00570: HRDC 
Click on image for an interactive view with Cn3D
HRDC domain
The HRDC (Helicase and RNase D C-terminal) domain has a putative role in nucleic acid binding. Mutations in the HRDC domain cause human disease. It is interesting to note that the RecQ helicase in Deinococcus radiodurans has three tandem HRDC domains.
Statistics
?
Aligned: 126 rows
Threshold Bit Score: 47.9312
Threshold Setting Gi: 122014832
Created: 23-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1WUD_A        12 DRKLFAKLRKLRKSIADESNVPPYVVFNDATLIEXAEQXPITASEXLSVNGVGXRKLERFGKPFXALI 79  Escherichia coli
Q23S17       466 KFRILKRLLEWRYKMAAKYDENPTFVLANDILFNIVNRLPQTQKEFASSNLKLSYVCQYHANEILSII 533 Tetrahymena thermophila SB210
Q6ALQ9       627 HPKLFASLRKWRTVKAKEEKIPAFQVLHQSAMVQITVSLPKSDKELLKLKGVGPRTVEKYGEELLSLV 694 Desulfotalea psychrophila
Q5LD80       637 HPELYKQLIAWRNSEAAKAGLPVYTIIQQKAILGIVNLLPNDAASLIRIPYFGKRGAEKYGDALLEMV 704 Bacteroides fragilis NCTC 9343
Q3A7R1       305 VEGRMKDLKQVRAAMAEELDMDPGILVNNAQLEGVARACPADMDQLTELGILKNWQREVLGEGLLGAL 372 Pelobacter carbinolicus DSM...
Q39Q73       311 EERRIKALKGWREDKARRFAVEPGFLANNALLEQIALVFPRSEVELEGIAGLRPWQRREFGAEMVAAL 378 Geobacter metallireducens G...
Q74G09       310 EEDRLKRLKEWRTEEAGRLGIEPGYIANNALLELVAVKAPRTMGDLEALPPMRCWQRSEFGEQILSIV 377 Geobacter sulfurreducens
Q8EYX1       334 eGERFKRLRIWRETIMSIRRMSHQMMPSNKMIAELSQKNPKTLDELRKMNLFSEWKVIHYGPSILAAL 401 Leptospira interrogans
Q2LWK2       268 SKGRLKKLYRWRFHKARQTNRAMFLILPDSALLSLSEGNWQSVEELRSAGILSEGKTDLYGSELMKVL 335 Syntrophus aciditrophicus SB
WP_011941060 338 QEERLKRLKEWREGKGAALGLSVGIIANNSLLEALSEAAPDSLEKLAGIPGLKRWQKQEFGAELLDLL 405 Geobacter uraniireducens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap