1PIL,1HWU


Conserved Protein Domain Family
P-II

?
pfam00543: P-II 
Click on image for an interactive view with Cn3D
Nitrogen regulatory protein P-II
P-II modulates the activity of glutamine synthetase.
Statistics
?
PSSM-Id: 278943
View PSSM: pfam00543
Aligned: 78 rows
Threshold Bit Score: 79.819
Threshold Setting Gi: 81343549
Created: 13-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1PIL_A         4 IDAIIKPFKLDDVREALAEVG-ITGMTVTEVKGFGRQKGH-TELYRGA-----------------EYMVD-FLPKVKIEI 63  Escherichia coli
Q8TRG8         4 IIAIIRPKKVEPTKEALVELG-IPSVTVVPVFGRGKQR----G-IAEElnidirpglldqgllagMKYME-FIPKRLLYL 76  Methanosarcina ...
Q8TRG5         4 VTAVVRPNKMSTTKDALDKIG-FPAMTAIPVLGKGKQRGI-SGELNFYiqprl-------lakrySTGMK-YIPKRLLSI 73  Methanosarcina ...
Q8AAC0         4 IEAIIRKTKFEDVKDALLEAD-IEWFSYYDVRGIGKARQG--RIYRGV-----------------VYDTS-TIERILVSI 62  Bacteroides the...
Q8KF33         4 IEAIIRTSQYEAVKKALHEID-IDFFTWWDVTGQGNDKKHrTEIYRGT-----------------VRDTS-YISRRYLSI 64  Chlorobaculum t...
Q8XSE5         4 IRIVVRPQLLERMHEALRGCAgFPGMTVGEVSGYPPTASL-AGAHSIK-----------------EDLTE-FVPRVRIEI 64  Ralstonia solan...
Q97L81         8 VDIVTRPEKFDELKSELNKIG-VTGMTVTNVLGCGLQKGT-LEYYRGN-----------------PVEIT-LNPKIKVEI 67  Clostridium ace...
Q07428         8 VEIVTRPANFEKLKQELGKIG-VTSLTFSNVHGCGLQKAH-TELYRGV-----------------KIESN-VYERLKIEI 67  Bacillus subtil...
Q97ME3         4 IMAIIRMNMVEKTKEALLKGG-NPAITCLKVLGRGRQKVD-FSMIEDYipnlmd-----qkmaeeLSEIHrLISKRLIII 76  Clostridium ace...
WP_003723521   7 IEIITRPNRFHLFQKELAKIG-VSGLTVTKALGTGLEKGF-IELYRGT-----------------KKESN-IHERMKIEI 66  Listeria monocy...
1PIL_A        64 VVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRI-RTG 105 Escherichia coli
Q8TRG8        77 IVSDEDVDTAVDTIIKVNQTAQIGDGRVFICPVDNAIRV-RTD 118 Methanosarcina acetivorans
Q8TRG5        74 VVNDEDVDLVVKTIIEVNQTAQIGDGRIFVEPIDDVIRI-RTG 115 Methanosarcina acetivorans
Q8AAC0        63 VVRDKNAEKTVQAIIKAAQTGEIGDGRIFVIPIEDAIRI-RTA 104 Bacteroides thetaiotaomicron
Q8KF33        65 VVRDVNLQKTVDCLIKNARTGEVGDGKIFVSDIEQSYRI-RTG 106 Chlorobaculum tepidum
Q8XSE5        65 VASDVLAGQMFDAAVKVLEHGQTGDSAIWMTEVVQATFLhRTG 107 Ralstonia solanacearum
Q97L81        68 VVCSVPVEKVVETAKNVLNTGKIGDGKIFVYDVSKVVKI-RTG 109 Clostridium acetobutylicum
Q07428        68 VVSKVPVDQVTETAKRVLKTGSPGDGKIFVYEISNTINI-RTG 109 Bacillus subtilis subsp. subtilis str. 168
Q97ME3        77 LAKDEDVKEIVDEIIEVNRTGNPGDGKIFVINIADAMRI-RTE 118 Clostridium acetobutylicum
WP_003723521  67 VVSTVPVEDVLRVVKETLRTGEPGDGKVFIYPLAEVVKI-STG 108 Listeria monocytogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap