3MHY,2XUL,3LF0,2J9C,3NCP,3T9Z,1UFL,3L7P,4RX6


Conserved Protein Domain Family
P-II

?
pfam00543: P-II 
Click on image for an interactive view with Cn3D
Nitrogen regulatory protein P-II
P-II modulates the activity of glutamine synthetase.
Statistics
?
Aligned: 86 rows
Threshold Bit Score: 79.8203
Threshold Setting Gi: 81343549
Created: 23-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3MHY_A     4 VMAIIKPFKLDEVREALTSLG-IQGLTVSEVKGFGRQKGQ-TEIYRGA-----------------EYSVS-FLPKVKVEV 63  Azospirillum
Q8TRG8     4 IIAIIRPKKVEPTKEALVELG-IPSVTVVPVFGRGKQR----G-IAEElnidirpglldqgllagMKYME-FIPKRLLYL 76  Methanosarcina acet...
Q8TRG5     4 VTAVVRPNKMSTTKDALDKIG-FPAMTAIPVLGKGKQRGI-SGELNFYiqprl-------lakrySTGMK-YIPKRLLSI 73  Methanosarcina acet...
Q8AAC0     4 IEAIIRKTKFEDVKDALLEAD-IEWFSYYDVRGIGKARQG--RIYRGV-----------------VYDTS-TIERILVSI 62  Bacteroides thetaio...
Q8KF33     4 IEAIIRTSQYEAVKKALHEID-IDFFTWWDVTGQGNDKKHrTEIYRGT-----------------VRDTS-YISRRYLSI 64  Chlorobaculum tepidum
Q8XSE5     4 IRIVVRPQLLERMHEALRGCAgFPGMTVGEVSGYPPTASL-AGAHSIK-----------------EDLTE-FVPRVRIEI 64  Ralstonia solanacearum
Q97L81     8 VDIVTRPEKFDELKSELNKIG-VTGMTVTNVLGCGLQKGT-LEYYRGN-----------------PVEIT-LNPKIKVEI 67  Clostridium acetobu...
Q07428     8 VEIVTRPANFEKLKQELGKIG-VTSLTFSNVHGCGLQKAH-TELYRGV-----------------KIESN-VYERLKIEI 67  Bacillus subtilis s...
CAC99595   7 IEIITRPNRFHLFQKELAKIG-VSGLTVTKALGTGLEKGF-IELYRGT-----------------KKESN-IHERMKIEI 66  Listeria monocytoge...
Q97ME3     4 IMAIIRMNMVEKTKEALLKGG-NPAITCLKVLGRGRQKVD-FSMIEDYipnlmd-----qkmaeeLSEIHrLISKRLIII 76  Clostridium acetobu...
3MHY_A    64 AVSDDQYEQVVEAIQKAANTGRIGDGKIFVLDIAQAVRI-RTG 105 Azospirillum
Q8TRG8    77 IVSDEDVDTAVDTIIKVNQTAQIGDGRVFICPVDNAIRV-RTD 118 Methanosarcina acetivorans
Q8TRG5    74 VVNDEDVDLVVKTIIEVNQTAQIGDGRIFVEPIDDVIRI-RTG 115 Methanosarcina acetivorans
Q8AAC0    63 VVRDKNAEKTVQAIIKAAQTGEIGDGRIFVIPIEDAIRI-RTA 104 Bacteroides thetaiotaomicron
Q8KF33    65 VVRDVNLQKTVDCLIKNARTGEVGDGKIFVSDIEQSYRI-RTG 106 Chlorobaculum tepidum
Q8XSE5    65 VASDVLAGQMFDAAVKVLEHGQTGDSAIWMTEVVQATFLhRTG 107 Ralstonia solanacearum
Q97L81    68 VVCSVPVEKVVETAKNVLNTGKIGDGKIFVYDVSKVVKI-RTG 109 Clostridium acetobutylicum
Q07428    68 VVSKVPVDQVTETAKRVLKTGSPGDGKIFVYEISNTINI-RTG 109 Bacillus subtilis subsp. subtilis str. 168
CAC99595  67 VVSTVPVEDVLRVVKETLRTGEPGDGKVFIYPLAEVVKI-STG 108 Listeria monocytogenes EGD-e
Q97ME3    77 LAKDEDVKEIVDEIIEVNRTGNPGDGKIFVINIADAMRI-RTE 118 Clostridium acetobutylicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap