4I3H


Conserved Protein Domain Family
DNA_topoisoIV

?
pfam00521: DNA_topoisoIV 
Click on image for an interactive view with Cn3D
DNA gyrase/topoisomerase IV, subunit A
Statistics
?
PSSM-Id: 334125
View PSSM: pfam00521
Aligned: 86 rows
Threshold Bit Score: 341.051
Threshold Setting Gi: 123853592
Created: 14-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4I3H_A        676 RALPDIRDGLKPVQRRILYSMNKdsNTFdKSYRKSAKSVGNI--MGNFHpHGDSSIYDAMVRMSQNWKN--REILVEMHG 751  Streptococcus...
P34534        720 RSIPSLIDGLKPSQRKILWTLLN--NMDeSTEIKVSQLAGAVahRQSYH-HGEESLVRTIIRMGQTFCGssNLPLLQPIG 796  Caenorhabditi...
A0BK44        365 RSIPSSIDGLKPTQRKIIHTLLN--HS--KQEYKVSSLSGLVttYAQYH-HGEQSLQQTVVAMAQNFTGsnNINLLLPIG 439  Paramecium te...
Q6RCM0        674 RSIPSVVDGLKPSQRKVLWTCLE--KNI-MKELKVSQLSGLVseKSSYH-HGEVSLQATIVNMAQNFCGsnNVNWLLPSG 749  Entamoeba his...
Q4UEG9        681 RSIPSVIDGFKPGQRKVLFGCFK--RNL-KNECKVAQLTGYIaeHSAYH-HGENSLQQTIINMAQDYVGsnNINLLLPCG 756  Theileria ann...
Q4Y8Y8        229 RSIPNIMDGWKPGQRKVLYGCFK--RNL-RNECKVAQLVGYIaeHSAYH-HGESSLQQTIINMAQTFVGsnNINFLEPCG 304  Plasmodium ch...
Q383C4        683 RSIPSVVDGLKPGQRKIMFSAFK--RNL-VRSLKVAQLAGYVseHAAYH-HGEQSLVQTIVGLAQDYVGanNVPLLYRDG 758  Trypanosoma b...
Q6C7Z9        783 RSIASVCDGFKPGQRKVLFGSFK--RKF-TVSIRVAQLVGYIseHTGYH-HGEASLGSTIMAMAQDFAGsnNIYLMKPDG 858  Yarrowia lipo...
XP_001566276  679 RSIPSAIDGFKPGQRKILFSCFK--RNL-VNSIKVVQLAGYVseHSAYH-HGEQSLVQTIVGMAQDFVGsnNVPLLRKDG 754  Leishmania br...
XP_001611613  680 RSIPSVVDGWKPGQRKVLFGCLK--RNL-VGECKVAQLTGYVaeHSAYH-HGEASLQQTIINMAQNFVGsnNINVLEPCG 755  Babesia bovis...
4I3H_A        752 NNGSm-DGDPP-AAMRYTEARLSEIAGYLLQDIEKKTVPFAWNfDDTEKEPTVLPAAFPNLLVNGSTGISAGYATDIPPH 829  Streptococcus...
P34534        797 QFGTrhEGGNDaASARYIFTALAPTTRLLFPQADDDLLQKNVE-EGMVVEPTWLCPIVPLILINGTEGIGTGWSTKIANR 875  Caenorhabditi...
A0BK44        440 QFGTrsMGGKDaAQARYISTKLSSLTTKLFNEDDLHTLNYLDE-EGYTVEPFWFTPILPLVLINGAEGIGTGWSTQVPNF 518  Paramecium te...
Q6RCM0        750 QFGSrlGGGKDqAAARYIYTRLSSISRYLCPKDDDQILEYLID-EDRRIEPKYYFPIIPTVLVNGADGIGTGWSTAVSNY 828  Entamoeba his...
Q4UEG9        757 QFGSrkEGGKDaAAARYIFTKLSPLTRYIFLQEDDPILDYQND-DGQIIEPYYYLPIIPMVLVNGAEGIGTGFSTFIPSY 835  Theileria ann...
Q4Y8Y8        305 QFGSrkEGGKDaSAARYIFTKLASSTRSIFNEFDDPILKYLNE-EGQKIEPQYYIPVIPTILVNGCEGIGTGYSSFIPNY 383  Plasmodium ch...
Q383C4        759 QFGTrlQGGKDhAAGRYIFTRLTDIARRIYHPSDDFIVEYRDD-DGLSVEPFYYVPVIPMVLVNGTAGIGTGFATNIPNY 837  Trypanosoma b...
Q6C7Z9        859 GFGSrsQGGKDaAAMRYAQTELMDITKAIFNKQDEPLYNYVTD-DDTPVEPEYYLPVLPMLLVNGCEGIGSGWSTSIPPY 937  Yarrowia lipo...
XP_001566276  755 QFGTrlHGGKDhAAGRYIFTRLMHVARAIFHPADDFVVEYKDD-DGLSVEPFYYIPVIPMVLVNGTTGIGTGFSTSIPNY 833  Leishmania br...
XP_001611613  756 QFGSrkEGGKDaSAARYIFTKLNPITRLIFVEEDDNILEYQNE-EGQTIEPMYYIPTIPMVLVNGSEGIGTGFSSQIPNY 834  Babesia bovis...
4I3H_A        830 NLAEVIDAAVYMIDHPtakIdklMEfLPGPDFPTGAIIQ---GRDEikkaYETGkGRVV-VRSKtEieklkggkeQIVIT 905  Streptococcus...
P34534        876 NPIDIIDMIRRKIDSIs--T----EyEIPPFYEEFRGKL----EVVtptkFISS-GKIQlIRPErKnas----tfSIEIV 940  Caenorhabditi...
A0BK44        519 NPREICQQIKRKLRGE---E---FE-ELVPWYKGFTGSI-----TAgtnqYIAK-GSFI-QHKN-----------HLYIT 573  Paramecium te...
Q6RCM0        829 NPLDLVDNCRRYLNGE---E---FK-EMKPWFRGWTGQLr---kNKdgsgYDCY-GKWR-RLSE-D---------KIEIT 886  Entamoeba his...
Q4UEG9        836 NPIDIIDNIVNFLDNK---D---MN-DMIPWYRNFKGTVtrnSKLG----YDII-GNYE-LNHSiN---------QLVIT 893  Theileria ann...
Q4Y8Y8        384 NYKDIINNIKKYIDKE---P---LV-PMVPWYKDFKGRIesnGKSG----YETI-GIIN-KIDD-E---------TLEIT 440  Plasmodium ch...
Q383C4        838 SPLDVIDNLNRLLSGE---E---LQ-PMKPWYFGFTGTIeerEKGK----FVSS-GCAT-VRPD-G---------VVHIT 894  Trypanosoma b...
Q6C7Z9        938 NPLDIVDNLRRMLKDE---P---PV-PMIPWFRGWHGEVepvGDGR----YKVK-GLIE-QVDE-R---------TLCIT 994  Yarrowia lipo...
XP_001566276  834 NPLEVIRNLERLMRGE---E---VH-KMQPWYFGFTGTMeekEPGK----FISH-GRYE-VRPD-G---------VVCIT 890  Leishmania br...
XP_001611613  835 NPLDIIDNLKRYLNNV---D---MK-PMVPWYHKFTGEIepnDKGG----FDCL-GNYQ-WLDEnG---------LLEIT 892  Babesia bovis...
4I3H_A        906 EIPYEINKANLVKKIDDVR-VNN-----KVAgiaEVRDE-SDRdGLRIAIELKK-DAN---TELVLNyLFKYTDLQINYN 974  Streptococcus...
P34534        941 ELPIGIWTSKYKEKLSKIV-ETL-----PVL---EFSERhTEK-RVHFRITLDR-KKSsrfLQKSNSdLLNYFKLRTSLT 1009 Caenorhabditi...
A0BK44        574 EIPPKKSVKEYQAFIQSKMeVAEgksepEIL---DMKEYhAGN-KVCFELKVT--------DEVLKQdIEKYFKLQTTIA 641  Paramecium te...
Q6RCM0        887 ELPIQIWTDSYKQHLEKCIeAK------IVK---GYSEYhMVN-TVHFVIDLV----Q---PMSDED-IWTNLKLVSSVK 948  Entamoeba his...
Q4UEG9        894 ELPINRWTNDYREYLNSIMaTNKed-egYIT---DYGDFsSNE-FIKIKIKLNd------sGPDITDdIEKVFKLKTTIS 962  Theileria ann...
Q4Y8Y8        441 ELPIKRWTQDYKEFLEELL--TDek-nqLIL---DYIDNsSHE-DVCFTIKMDpvKLK---KAEEEG-LEKVFKLKSTLT 509  Plasmodium ch...
Q383C4        895 ELPIGTWTQQYKKFLEDLReRE------IVI---QYREHnTDV-TVDFEVFIHpeVLR---QWVAQGcVEERLQLREYIH 961  Trypanosoma b...
Q6C7Z9        995 ELPARMWTISMKEFLLSSLiDSKne-kgWIE---DFTEDhGF--RVKFNITLSekEME---KTRQIG-LRERFKLISSLS 1064 Yarrowia lipo...
XP_001566276  891 ELPIGVWTQTYKKFLEDMReKE------LVV---QYREHtTDV-TVDFEVFLHpqVLE---QWVAQDvVEERLQLKEYVH 957  Leishmania br...
XP_001611613  893 ELPIRKWTHDYRVFLESLEqGVNgk-epLIL---GFVDNsTHE-SVHFTLNVNpeCIE---EVINEG-VDKVFKLRTSIA 963  Babesia bovis...
4I3H_A        975 FNMVAIDNF-T--PRQVGIVPILSSYIAHRREVILARSRFDKEKAEKRLHIVEglirviSILDEVIALIRASEN-KADAK 1050 Streptococcus...
P34534       1010 ENRVLFDRNgEl-KEFGNISEIAAEFFEVRRDLYEKRLKIQKEECEAKLIYVE------NQLNFIEMVTNGTIEiRSMGR 1082 Caenorhabditi...
A0BK44        642 MTNLVLFNEkGllKRYSNVSEILDEFYQTRIKFYQLRKEYLLSKYQNELELVQ------SKSKFIEGMIDNSIQlRGLKK 715  Paramecium te...
Q6RCM0        949 TTNMHLFNSeYkiTKYHTVLDILSEFCDVRMKGYEERKKAIIESMERQLMILS------NKARFIKMVIEGELIvNNRKK 1022 Entamoeba his...
Q4UEG9        963 TSNMILFDCnKriKKYNGAIDILKDFITTRVKYYTKRREYMIKQLQLQLQQLS------NQIRFINMIINNELViFRKSK 1036 Theileria ann...
Q4Y8Y8        510 TTNMTLFDSnLklQRYASELDILKDFCFHRLNAYNERKSYLISKLEKEKRIIS------NKTKFILAIINGELVvNKKKK 583  Plasmodium ch...
Q383C4        962 ATNIIAFDReGkiTKYLDAESVLKEFYLVRLEYYARRREFLLEQLQRAALKLE------NMVRFVNEVIDGTFIvTRRSM 1035 Trypanosoma b...
Q6C7Z9       1065 TSNMVAFDPeGriKKYDSPEAIMKEYFPVRLEFYQKRKDRLVSDFEQQLEKLT------AQARFIKLIIDKKLNiNNKGR 1138 Yarrowia lipo...
XP_001566276  958 ATNIIAFNKeGqiTKYWDAESVLKDFYLVRLDYYAKRKDYLLGELRRLTSKLE------NMVRFVREVVEGTLVvTKRKK 1031 Leishmania br...
XP_001611613  964 TTNMTLFDAnKklKRYSNELEIIRDFAAVRLATYEKRKTYLINNLKLLLRRIS------NQVRFIHMVVNEELVlFKKAK 1037 Babesia bovis...
4I3H_A       1051 ENLKVSydFTE-------------------------------------------------------------------EQ 1063 Streptococcus...
P34534       1083 NQLEEK--LQEmgfrvdpma--------------------------------------------------tiaknskkAN 1110 Caenorhabditi...
A0BK44        716 MEMCKK--LQSlgfkgiskmekvkst----------------------------------------riskdfdadnlekq 753  Paramecium te...
Q6RCM0       1023 NELYKD--LIKfgfdqirdpkkankskpig--------------------------------eseddeikeeeeddevgg 1068 Entamoeba his...
Q4UEG9       1037 KQIVSE--LKRlnfntykpeee------------------------------------------------edeedndieg 1066 Theileria ann...
Q4Y8Y8        584 KILVEE--LYRkgydpykdihkvkkeeifeqel--------------------------leaaenpedneeiiagvtvkd 635  Plasmodium ch...
Q383C4       1036 KDVLKD--LKQrgytpfppqqkkkmssttivdeedndgarkilpdvfefesvplceqvigkilctaepeeinmwkgvlVE 1113 Trypanosoma b...
Q6C7Z9       1139 KVLIAE--LSElkfprygkngerlasdakaaiaed-------------------eeapsdevaedlaeaeeihgkiptNG 1197 Yarrowia lipo...
XP_001566276 1032 KELLED--LQGrlylpfpphakkklssttveeeggeaepttq-----nseedvlgmgsaadggvddgdaetpevrratRN 1104 Leishmania br...
XP_001611613 1038 ATLVAE--LRDlgfdsntdilkgseepstl-------------------------------nepvtpsrrsgtqdapgad 1084 Babesia bovis...
4I3H_A       1064 AEAIVTLQLYRLTNTDVVVLQEEEAELREKIAMLAAIIGD 1103 Streptococcus pneumoniae TIGR4
P34534       1111 YGYLLEMPVSRLTSDEMKRLEERKSRRRTELEAAESADWK 1150 Caenorhabditis elegans
A0BK44        754 YDYLLSMPMWNFSEEKITAFKQQIKQLQDQITALNKKTPQ 793  Paramecium tetraurelia
Q6RCM0       1069 YDYLLSMKIWTLTYEKAKKLMEDCDDLKTQIDTIKTTPVK 1108 Entamoeba histolytica
Q4UEG9       1067 FNYLLKMSLLSLTLDHINKLNNEYNSKQVQLKELINTTPI 1106 Theileria annulata
Q4Y8Y8        636 YNYLLNMPIFSLTLEKVEELLAQLKEKEQELEILKSITVE 675  Plasmodium chabaudi
Q383C4       1114 YDYLLSLRMVDLTVEMAMYFRTKREQMLNKHNFVLSASSK 1153 Trypanosoma brucei
Q6C7Z9       1198 YDYLLGMALWSLTKERYEKLLRERDGKEEELIELLKKSAK 1237 Yarrowia lipolytica
XP_001566276 1105 YDYLLGMKLWSLTAEMIARLEAQLARARHDTATMEARTPK 1144 Leishmania braziliensis MHOM/BR/75/M2904
XP_001611613 1085 YNYLLNMPLWSLTLEQVQKLNEEHAQKENQLRILLETTAT 1124 Babesia bovis T2Bo
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap