4UI9,4UI9,1W3B,3PE3,3PE3,3PE3,5A01,2VYI,4JA7,3FP2,4GCN


Conserved Protein Domain Family
TPR_1

?
pfam00515: TPR_1 
Click on image for an interactive view with Cn3D
Tetratricopeptide repeat
Statistics
?
PSSM-Id: 334122
View PSSM: pfam00515
Aligned: 562 rows
Threshold Bit Score: 28.5339
Threshold Setting Gi: 2842595
Created: 16-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4UI9_F    635 YNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQ 667  human
O26730     36 ADTLFRIGREYHRISRTDLAIESYRNALELYRE 68   Methanothermobacter thermautotrophicus str. Delta H
P73719    334 AEVWLSRGLLLEAMERKEEAIPSYEKALTLEPT 366  Synechocystis sp. PCC 6803
O27622    233 AEVWTARGNLLSDLGRMEEAIESYNSALELALE 265  Methanothermobacter thermautotrophicus str. Delta H
O82039    402 AEAYNNLGVLYRDAGNISLAIEAYEQCLKIDPD 434  Petunia x hybrida
Q96301    397 AEAFNNLGVLYRDAGNITMAIDAYEECLKIDPD 429  thale cress
Q96301    220 AEAYCNMGVIYKNRGDLEMAITCYERCLAVSPN 252  thale cress
O82039    116 ACALTHCGILYKDEGRLVEAAESYQKALKADPS 148  Petunia x hybrida
EMS67383  208 AEAYCNMGVIYKNRGELDAAIACYDRCLTISPN 240  Triticum urartu
BAK03336   88 AEAYNNLGVLYRDAGSITLSVQAYERCLQIDPD 120  domesticated barley
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap