3FWV,3UQ3,4JA7,4GCO,3FWV,3FP4,2GW1,5MGX,1P5Q,2XPI,5G05,5G05,2XPI,3FP4,2GW1,5G05,4GYO,5OJ8,6FV0,5OJ8,6EJN,6EJN,5OJ8,6FV0,6I57,2Y4T,3IEG,5LYP,3UQ3,4GCO,6I57,6HFT,4JA7,1P5Q,3IEG,2Y4T,5JHE,5MGX,5G05,5LYP,2VYI


Conserved Protein Domain Family
TPR_1

?
pfam00515: TPR_1 
Click on image for an interactive view with Cn3D
Tetratricopeptide repeat
Statistics
?
PSSM-Id: 395414
View PSSM: pfam00515
Aligned: 551 rows
Threshold Bit Score: 27.0028
Threshold Setting Gi: 1723340
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3FWV_A  79 AYAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTP 112 human
O04843 482 VKALYRRAQAYTELVDLELAELDIKKALEIDPDN 515 bread wheat
Q43207 484 VKALYRRAQAYTQLADLELAEVDIKKALEIDPEN 517 bread wheat
O35450 284 LKALYRRGVARAALGDLEKATADFKKVLAVDPKN 317 house mouse
P27124 353 EKGLFRRGEAHLAVNDFDLARADFQKVLQLYPSN 386 rabbit
P30416 353 EKGLFRRGEAHLAVNDFDLARADFQKVLQLYPSN 386 house mouse
1P5Q_B 230 EKGLSRRGEAHLAVNDFELARADFQKVLQLYPNN 263 human
Q13451 351 EKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQN 384 human
Q64378 351 EKGLYRRGEAQLLMNDFESAKGDFEKVLAVNPQN 384 house mouse
Q92623 164 FKALYRSGVAFYHLGDYDKALYYLKEARTQQPTD 197 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap