5LYN,2VYI,5LYN,4UI9,4UI9,6EOU,5LVV,5LVV,5LVV,5A01,4JA7,3FP2


Conserved Protein Domain Family
TPR_1

?
pfam00515: TPR_1 
Click on image for an interactive view with Cn3D
Tetratricopeptide repeat
Statistics
?
Aligned: 560 rows
Threshold Bit Score: 28.5448
Threshold Setting Gi: 417380
Created: 22-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5LYN_A  78 FRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDN 111 baker's yeast
O51085  24 ALGHYQRANEYYLSKRYYDAIDELVEAIKINPNY 57  Lyme disease spirochete
P72802 110 AYALGNRCYAYFLLSQYDKAIQDCSNAIEINPNY 143 Synechocystis sp. PCC 6803
P91189 325 ADILCERAEAHILDEDYDSAIEDYQKATEVNPDH 358 Caenorhabditis elegans
Q13217 340 VNALKDRAEAYLIEEMYDEAIQDYETAQEHNEND 373 human
Q27968 340 VNALKDRAEAYLIEEMYDEAIQDYETAQEHNEND 373 cattle
Q13217 105 TAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSE 138 human
Q27968 105 TAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSE 138 cattle
P47103 330 AKAYYRRGNSYLKKKRLDEALQDYIFCKEKNPDD 363 Saccharomyces cerevisiae S288C
Q99614 189 IRAILRRAELYEKTDKLDEALEDYKSILEKDPSI 222 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap