Conserved Protein Domain Family
TPR_1

?
pfam00515: TPR_1 
Click on image for an interactive view with Cn3D
Tetratricopeptide repeat
Statistics
?
PSSM-Id: 278916
View PSSM: pfam00515
Aligned: 555 rows
Threshold Bit Score: 26.9969
Threshold Setting Gi: 1723340
Created: 21-Jun-2015
Updated: 5-Aug-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

pfam00515 is a member of the superfamily cl22897.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30
                 ....*....|....*....|....*....|....
4RG9_B       337 AYAYTLLGHEFVLTEELDKALACFRNAIRVNPRH 370
gi 81815973   24 ALGHYQRANEYYLSKRYYDAIDELVEAIKINPNY 57
gi 74961467  325 ADILCERAEAHILDEDYDSAIEDYQKATEVNPDH 358
gi 73620802  340 VNALKDRAEAYLIEEMYDEAIQDYETAQEHNEND 373
gi 123794509 340 VNALKDRAEAYLIEEMYDEAIQDYEAAQEHNEND 373
gi 407957284  54 ADAYYNRGYAKHVLGQYQAAITDYNQAISLNPEF 87
gi 407958687  61 ADAYFNRGIARARIADYQGAITDHSQAITLNPQL 94
gi 1001204   151 AFAYNNRGNAEGGLGNWTSALEDFQQATAIAPNF 184
gi 407961841  86 ADAYNLRGVAYMVIEQYTDALADFDQAIALNPKD 119
gi 743727939 637 VNALKDRAEAYLIEEMYDEAIQDYETAQEHNEND 670
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap