1O4X,2GZK,2LHJ


Conserved Protein Domain Family
HMG_box

?
pfam00505: HMG_box 
Click on image for an interactive view with Cn3D
HMG (high mobility group) box
Statistics
?
Aligned: 29 rows
Threshold Bit Score: 61.4722
Threshold Setting Gi: 74582080
Created: 22-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1O4X_B         8 VKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDY 75  human
P0CY17       103 TPRPPNAFILYRKEKHATLLKSNPSINNSQVSKLVGEMWRNESKEVRMRYFKMSEFYKAQHQKMYPGY 170 Schizosaccharomyces pombe 9...
Q10116       147 TSRPRNQFVLYYQWLLDTLFSEDPSLSARNISQIVAGLWNSEHPAAKARFRELAEMEVHRHRAENPHL 214 Neurospora crassa OR74A
P48046        60 VKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNY 127 western lowland gorilla
P48430        39 VKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPFIDEAKRLRALHMKEHPDY 106 chicken
Q06945        59 IKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDY 126 human
AAL28011       8 IPRPPNAYILYRKDHHREIREQNPGLHNNEISVIVGNMWRDEQPHIREKYFNMANEIKTRMLLEHPDY 75  Neurospora cerealis
XP_007698552 125 aPRPMNCWIIFRDAMHKHLKAEFPHLTIQEISTQCSQIWHNLSPEAKRPWQDAAQSAKEEHLRQHPNY 192 Bipolaris sorokiniana ND90Pr
EGV92395      15 VKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESEKRPFVEEAERLRVQHKKDHPDY 82  Chinese hamster
1814445B     132 IPRPPNAYILYRKDQQAALKAANPGIPNNDISVMTGGMWKKESPEVRAEYQRRASEIKAKLMSAHPHY 199 Podospora anserina
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap