1CG7,1O4X,2GZK,2LHJ


Conserved Protein Domain Family
HMG_box

?
pfam00505: HMG_box 
Click on image for an interactive view with Cn3D
HMG (high mobility group) box
Statistics
?
PSSM-Id: 334118
View PSSM: pfam00505
Aligned: 30 rows
Threshold Bit Score: 61.471
Threshold Setting Gi: 74582080
Created: 14-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
1CG7_A        21 PKRALSAYMFFANENRDIVRSENPDITFGQVGKKLGEKWKALTPEEKQPYEAKAQADKKRYESEKELY 88
gi 338818321 103 TPRPPNAFILYRKEKHATLLKSNPSINNSQVSKLVGEMWRNESKEVRMRYFKMSEFYKAQHQKMYPGY 170
gi 1346491   147 TSRPRNQFVLYYQWLLDTLFSEDPSLSARNISQIVAGLWNSEHPAAKARFRELAEMEVHRHRAENPHL 214
gi 1351116    60 VKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNY 127
gi 1351090    39 VKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPFIDEAKRLRALHMKEHPDY 106
gi 548952     59 IKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDY 126
1O4X_B         8 VKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDY 75
gi 6580580    18 IPRPPNAYILYRKDHHREIREQNPGLHNNEISVIVGNMWRDEQPHIREKYFNMSNEIKTRMLLEHPDY 85
gi 628067761 125 aPRPMNCWIIFRDAMHKHLKAEFPHLTIQEISTQCSQIWHNLSPEAKRPWQDAAQSAKEEHLRQHPNY 192
gi 228928    132 IPRPPNAYILYRKDQQAALKAANPGIPNNDISVMTGGMWKKESPEVRAEYQRRASEIKAKLMSAHPHY 199
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap