4FID,2XTZ,4QJ3


Conserved Protein Domain Family
G-alpha

?
pfam00503: G-alpha 
Click on image for an interactive view with Cn3D
G-protein alpha subunit
G proteins couple receptors of extracellular signals to intracellular signaling pathways. The G protein alpha subunit binds guanyl nucleotide and is a weak GTPase. A set of residues that are unique to G-alpha as compared to its ancestor the Arf-like family form a ring of residues centered on the nucleotide binding site. A Ggamma is found fused to an inactive Galpha in the Dictyostelium protein gbqA.
Statistics
?
PSSM-Id: 306901
View PSSM: pfam00503
Aligned: 133 rows
Threshold Bit Score: 116.162
Threshold Setting Gi: 290988598
Created: 12-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4FID_A         1 SNAK----PI-------TVXLLGSGESGKSTIAKQLK------ILFGGG------FPEQe-rAT-HKSSICSNVVTCXRT 55
gi 290979714  42 TSTTt--fGA-------NLLFSSRSDDL----FDELE---------DDDskssqsFQTS---TQ-FLSLLGHNILDQAKK 95
gi 290998896  94 VKKR-----M-------NVIMLGTGGSAKTTVLKQFK------LLG---------GKREdltQSlWQE---GIVVPCFDL 143
gi 290995843  64 VPETpesnKL-------RIVLIGGGGSGKTTLFKQRK------LVLGGG------FSERe-yEQ-ARLIVHTELLHVMYS 122
gi 290972639  32 venviaetDC-------ILALIGTGGCGK---RLEMK------------------FKEK---------ENSNNYLNRVKL 74
gi 290999126 255 KYESp--sVY-------TLMLSGTLGSGKTTLFRQFR------LVFQEG------FNRSe-iER-MRMYIITNLLQSFSL 311
gi 290988598  61 TINN-------------NIYCVGCSDGGKTSFHNQLKs-----KFHMKI------HKNEkirAT----LIIKTCLSSIQD 112
gi 290994320 153 SALQvyqsHI-------RFIFLASGESGRKTLSKLIRynlepeVIEKQA------FDLNqsySTlY--FFFSNTIILLEQ 217
gi 290992753  66 DEHMd--vGM-------VFAVVGTSWCGKSTIANVAR------QLFGPK------YGRNe-kAV-FGDLIRGSIVKSFSQ 122
gi 290983718  92 AFSGkdalVVenslekfKILLCGSGSSGKTTFLKSIE------LYKKGA------FMe---sAY-KKGIIYFNIIRDLGL 155
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4FID_A        56 LIEQSAIlnh-----------------------------pxKYQPKSKEFTTEDPV------------------------ 82
gi 290979714  96 VNDLHTTqvqsi------------------------piygnNRKDSVDLSKAPKLVlvgtgssd-----------sidni 140
gi 290998896 144 LIAIFNR------------------------------------KNFYYPNAEYHHEe----------------------- 164
gi 290995843 123 LAYELYNgdfv---------------------------sneNVKQIAHDFLKIVSEkcn--------------------- 154
gi 290972639  75 LSGQEYSl------------------------------------------Fp---------------------------- 84
gi 290999126 312 GVSLYLNevda--------------------------ikngTTKVTRENRFMLDETlyek-------------------f 346
gi 290988598 113 IIFIVMSd--------------------------------qERNDFIHKIKKSDPQiydflln--------------ltn 146
gi 290994320 218 FYQMLFElkfpnqcinel-------------ppilanvepqIIQEILKDLKEIEDIpmdrefsv-----------dqvnk 273
gi 290992753 123 LLNCLRNfldqedf---------------------vkehqrTIHDRLIELKIFKLKkslqtpnftssgceprglhseyea 181
gi 290983718 156 MCKQYLSvateflnfisglneenygkslsdlnemfprelprEITDSMDRLIKVASSknflhssasr-------ssskqyn 228
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4FID_A        83 ---TLPFSP-----------ELVG------------------------DVEALW-A--DE-------------------- 101
gi 290979714 141 lgdTTFLSD-----------EICE------------------------RLVDFWmD--EP-------------------- 163
gi 290998896 165 ---SDEVEQ---------------------------------------QVFDLF-D--QKkilniihpnnqklieeiaem 199
gi 290995843 155 -hnEHALINc---------iEHII------------------------EKSQLW-K--TF-------------------- 177
gi 290972639  85 ---ESVWNN-----------ELAK------------------------LIFQMY-Q--DE-------------------- 103
gi 290999126 347 kefDSRVTSlqsrytlfdisKLPQk----------------------eFVVSMW-E--DT-------------------- 381
gi 290988598 147 itrKWEFTKse-------siQYGQ------------------------YIRMIW-S--Ky-------------------- 172
gi 290994320 274 lsnNIPMASnckvvlklitkQVYN------------------------NLILFF-ErqDVk------------------- 309
gi 290992753 182 qksTIIATPimkeefeqlkrELIQyfaernevidrsldihsdvnrvvkLLESLW-N--DP-------------------- 238
gi 290983718 229 ptfDTYFNE-----------QTFE------------------------DIESLWkY--RPfnlfahfhlthssipefltp 271
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4FID_A       102 ------GIQAT-YE--ESa-KFQl---------pDCAKY---------L-FE-N---------VKRIAXE--DYVP---- 136
gi 290979714 164 ------IIQMC-YFfaSIayKFIe----------GYGDYsrnraeksvY-IR-HlnlenlptlIDQLEDVl-SYETegdd 223
gi 290998896 200 wnnepiLRKVC-TEmlLEn-QVEsv-------pvEDVNY---------Y--------------FSRAVAVhrGDKP---- 243
gi 290995843 178 ------FTKEI-FK--QVm-EFNpk-------fsSLFNFsv-----dpY-FS-E---------YDRVMHM--DFKP---- 218
gi 290972639 104 ------GFQNElFQ--NRq-RIPf---------lESINY---------FtDKkN---------SSRLLKN--DFQL---- 141
gi 290999126 382 ------DVRKV-LN--RYalTDSm---------tDGMDY---------Y-LR-Dhgd---tsaVKRMFKKlsEYEP---- 425
gi 290988598 173 -----kIIQEL-YY--LYk-DSHhl--------iDNIDV---------L-CN-Emnii--isqLSDHQKN--QFLKntkr 220
gi 290994320 310 -----lLIRKY-HDllQTq-QHGti--------fDRIEIlksvs---------------hetlCEILEKPsnSFTK---- 355
gi 290992753 239 ------IVQIV-YAlnHRipNLNv---------sTNLDY---------W-IP-R---------LKKIFSA--GFSP---- 276
gi 290983718 272 vltkmdTIPNItFGenESt-NYSkfmlslrnsdfDDLIY---------F-LDrR---------LNELYPPy-QYDP---- 326
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4FID_A           --------------------------------------------------------------------------------
gi 290979714 224 lqs----------------------------------------------------------------------------- 226
gi 290998896     --------------------------------------------------------------------------------
gi 290995843     --------------------------------------------------------------------------------
gi 290972639     --------------------------------------------------------------------------------
gi 290999126     --------------------------------------------------------------------------------
gi 290988598 221 rlnqrlnstteivtsnslncnqlennlydqddeedgeeqqqqdaedlyqldnhinnimnskkkskkisifsskfksnfns 300
gi 290994320     --------------------------------------------------------------------------------
gi 290992753     --------------------------------------------------------------------------------
gi 290983718     --------------------------------------------------------------------------------
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4FID_A       137 -------TE------------------EDLIHNr-----TKTTGIHEYDF-------VV--------K-DIPFHLIDVGG 170
gi 290979714 227 kfssaikDD------------------SHIVTElivstyVKTTGIIEIPV-------KF--------GdNNLIGLYDTGG 273
gi 290998896 244 -------SD------------------KDLLISq-----RKTTGVTHVEF-------AFn-------NgSTLVNIWDCGG 279
gi 290995843 219 -------LE------------------KDHIVFq-----KKTTGIVESSF-------EYmns--fivHlSITFR-FDSGG 258
gi 290972639 142 -------NF------------------DDFFFAs-----RKTTGISPFKY-----------------VnNHKKAIIDTGG 174
gi 290999126 426 -------SV------------------EDIIGCr-----CKTTGITCLDY-------DY--------L-GMPFRVYDVGG 459
gi 290988598 301 sqqnnnnTSlnnennnennntshydkySPLIKFl-------TIGKNETKF-------QF--------DsKNLFTILDLGG 358
gi 290994320 356 -------EE------------------EELILRlffisrQKLTGCSQFTL-------QL--------G-PHKLSFCLVAG 394
gi 290992753 277 -------KS------------------KDILQShpghngIYAHHPMECKFpknqtetVTeip--lfeAkEIPFVVLDVT- 328
gi 290983718 327 -------NW------------------VDLLHRr-----QKTVGFYHLNY-------VEdaiseegmReTRNYIFIDTAG 369
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4FID_A       171 QRSERKXWV--S-FFsdv------dcAIFVTSLAEYDXKLYEDGNTSRLTESIAVFKDIXTN---EFL-K--GAV---KL 232
gi 290979714 274 QRNERKKWK--N-IMndnsq--tlsgVLFLVPLSEYNQICYEDDSINRTIESLNLFSELVNR---NTF-G--SLP---FF 339
gi 290998896 280 QKNERKKWK--Y-MFtesqkltgkifVIYFVALSEYNQLCYEDETTNRTHESLKIFESVANN---PEY-E--NYP---LF 347
gi 290995843 259 QRNERKKWP--N-MFsqp-----vdsVWFVGSLSDFTKMCYENNTLNRFEDSLAVFSDWIDS---NTT-K--NIRd--FR 322
gi 290972639 175 QRTERSKWNrlHnTYsqk------lhIGFVISLSEFDELCYEDDITPRFNEGLSNFEEWYGS---PLV-S--EHT---LY 239
gi 290999126 460 ARTERKKYN--N-IYagl------tgVLYTTSLIDFRKTCYEDDFSNRMIESINLFEEQCNG---PLK----YSP---IF 520
gi 290988598 359 RGAEKKKWE--F-FLnetn----adfVLFFVSMSEFNQNLIESDNINRLHESLTIYRDIINR---ALLrN--TKD---II 423
gi 290994320 395 QRAERKKYP----RYmeqg----feyVIFCMNLSEYNRNLYENDTITRFRDTIYMAHEYCCQ---DCK-KygNMS---VI 459
gi 290992753 329 --DVSRKLE--H-VIdlv------tdIVFVVSMDDY--YLIDERNMDRLSDAIQKFRKLCEDmkeSFLsR--RIPlknIT 393
gi 290983718 370 QRSERKKWS--I-CYpnt------ftLFYFVSLADINLTLYESNVENRLLDSLHLFEHVCQE---PDL-I--QTP---IV 431
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4FID_A       233 IFLNKXDLFEEKL--TKV-----PLNT--If------------------PEYT---------------G-GDN------A 263
gi 290979714 340 LIFTKKLVMEEKL----------KLYDltYv------------------PFKT---------------ElPQD------L 370
gi 290998896 348 LIFTKKDIFKQKL--RYT-----SLSV--Cfedcp----------edlkANEDttkikrdiinnwtgfLeDRQcvsdeiY 408
gi 290995843 323 LILTHADELEEMHisPETi----SFLKsnLi------------------PH-----------------GnAKE------I 357
gi 290972639 240 LIFSKFEVLEEKI--KKGi----SFSR--Fv------------------SEFK---------------GdETS------I 272
gi 290999126 521 LIFTKIDILSETIsdDKS-----LFDLf---------------------PDFN-----------------QYP------V 551
gi 290988598 424 LIFTKPDIFLHKM--ENNi----EFKL----------------------PNIEglnipkmetirpellKlKDN------I 469
gi 290994320 460 PVFTHLDQLMRQI----------------Yy-------------------------------------GnVPN------S 480
gi 290992753 394 LVFNKFDIFSDKA--SKSedpfiKLET--Sh------------------PDIYtyyg-------tdsgAsQHL------I 438
gi 290983718 432 LFFTKTDILKRKIknGLK-----PIEL--FekieklysqryeaativdmPPSSatndteknselslniSsGNQ------A 498
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4FID_A       264 VXG-AQYIQ----QLFTGKlqt------eeXNIsgadgtaniegavnE----KVYTN--PTN-ATDGSNIKRvF-XLA-V 323
gi 290979714 371 KVE-LKLNEenkkDLLVNIlkmknsqidnlTPR--------------EiqliDRFSS--DTR-YSPSQLLKIiGgDKT-- 430
gi 290998896 409 EKS-FDFVK----RKFMERi---------sNAD--------------RrkqtEKNIK--VVN-AMDADDVRSnLvEELlE 457
gi 290995843 358 IDG----IT----AKYQLL-----------DKN--------------N----RLTQV--SVInCTDTEQIRDyL-TTT-L 396
gi 290972639 273 ESI-VEFIV----KKYLEL-----------DVK--------------R----RVVKY--YVIsAFKTEQVYQmL-NEI-F 314
gi 290999126 552 PDQ-NNFFT----NTSSQLnp--------nNNP-------------------QRYLL------DKEVQISQKvL-KTL-S 591
gi 290988598 470 KLE-INNLI----NLFENIhln------sfNNI-------------------TFKYH--IVN-IINIKECQEfI-EILlR 515
gi 290994320 481 ANV---WIPm--cEEIAKLhns-----rrsNVM--------------D----FIFSS--LIP-VKEVLNKLKyF-AFI-V 527
gi 290992753 439 RSL-IDYFVniydSYFRDI-----------REF-------------------PISKHqiETYrLTSSLLAGTiL-NIC-V 485
gi 290983718 499 NQVdAEF------NQFIEYisakfkekllpTQT--------------I----TIYT---LDC--TEPTQFKTtF-KEI-M 547

                 ....*.
4FID_A       324 Dv---I 326
gi 290979714 431 -----I 431
gi 290998896 458 Qt---M 460
gi 290995843 397 Ns---I 399
gi 290972639 315 Ei---- 316
gi 290999126 592 FieskF 597
gi 290988598 516 Qt---I 518
gi 290994320 528 Gy---P 530
gi 290992753 486 Ts---A 488
gi 290983718 548 Qm---L 550
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap