3JA8,3JA8,3JA8,5U8S,5V8F


Conserved Protein Domain Family
MCM

?
pfam00493: MCM 
Click on image for an interactive view with Cn3D
MCM2/3/5 family
Statistics
?
PSSM-Id: 366129
View PSSM: pfam00493
Aligned: 63 rows
Threshold Bit Score: 223.551
Threshold Setting Gi: 2497832
Created: 22-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3JA8_5       357 FLQLSRNP--KLYEILTNSIAPSIFGNEDIKKAIVCLLMGGSKKILPDGMR--LRGDINVLLLGDPGTAKSQLLKFV-EK 431 Saccharomyces c...
Q8SRK9       215 MGWFERRL------LLVNSFAEEIQGLENVKLGLLLALVSGSHGADQKSGT---RSNSHILLVGDSGTGKSHLLKTC-SR 284 Encephalitozoon...
Q9CWV1       386 IREIQAEE--NLLKLVVNSLCPVIFGHELVKAGLTLALFGGSQKYADDKNRipIRGDPHVLIVGDPGLGKSQMLQAA-CN 462 house mouse
Q8SQX1       277 FRKIAGAG--NTLASLVCSLYSAVYGNELIKVGLVLSLFGGTKKSAGQ-HS--IRSETHVLIVGDPGLGKSRLLLST-CG 350 Encephalitozoon...
Q8TWR7       255 FEELAEG---DPLGEFVEAVAPHIHGHEVIKKAVSLQLFSCVE---EG--Q--IRERVHVLIVGDPATAKSQILQHViEH 324 Methanopyrus ka...
Q57809       343 INRIAKDK--NVIQKLSDYAFREVTGYDMIKRAVLLQLVSSGTNID-------MRTSIHILMISDPGVGKSTLMESL-IQ 412 Methanocaldococ...
Q58884       275 IKKIAKRK--DVVNILADRLIPEIKGHSAIKKAVLLQQIKGVKK--PG-----KRADIHILLITDPGIGKTVILRKI-A- 343 Methanocaldococ...
EOA30066     195 ivKFKEEYgsDTFRRILHSVCPSIYGHEIVKAGITLSLFGGVRKHSMDRNKvpVRGDIHLIIVGDPGLGKSQLLQAA-AA 273 Capsella rubella
XP_001706593 306 LSVLREKA--IPLHVLIASFAPRIHGREDEKLACLCSLVGGNEIVVPD-MK--VRGNINTLFVGDPGCAKSALLKFT-CT 379 Giardia lamblia...
XP_653372    171 IKKVMKEE--NPINLLSKSIAPSIYGHSDVKKAILLMLVGATPKIRLR-SR--VRGDIHVMLCGDPSTAKSQLLRYV-MS 244 Entamoeba histo...
3JA8_5       432 VSPIAVYTSGKGSSAAGL-TASVQRDPMTRE---FYLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKA 507 Saccharomyces c...
Q8SRK9       285 LLSPAVLTNGVGTTQAGLtTCAVR---QGRE---WVLEAGALVLADTGLCCIDEFNKLKVNEKNGLLEAMEQQTLSIAKA 358 Encephalitozoon...
Q9CWV1       463 VAPRGVYVCGNTTTSSGL-TVTLSKDSSSGD---FALEAGALVLGDQGICGIDEFDKMGN-QHQALLEAMEQQSISLAKA 537 house mouse
Q8SQX1       351 ILPKSSYVSGSFTTTAGL-TVSLTHDPVSGE---YMADAGALVVADNGICCLDEFDKIDD--HAALFEAMEDQKVSIAKG 424 Encephalitozoon...
Q8TWR7       325 LAPRGVYVSAQHVTGAGL-TAA--AERTEDG---WTLEAGAVVMADGGVIAIDELDKASRGDLNALLEAMESGKISVAKA 398 Methanopyrus ka...
Q57809       413 KFPFVKKVYAVTSSGPGL-VGSVVREKAEFGd-sWVLKAGVLTEADGGVVCIDEFSRNKE-VYDYLLGVMEQQKIEINKA 489 Methanocaldococ...
Q58884       344 EIPGNLYGSVTTATGVGL-TAAVVREKTEIGedtWVIKPGLLVKAHKGTACIDELTVNKE-LQSYVLEAMESQTIHISKG 421 Methanocaldococ...
EOA30066     274 ISPRGIYVCGNATTKAGL-TVAVVKDSMTND---YAFEAGAMVLADGGLCCIDEFDKMTT-EHQALLEAMEQQCVSVAKA 348 Capsella rubella
XP_001706593 380 IAERGIYVAGRGASGAGL-TTAAIRIPGTTD---YSLEGGALVIADQGVCALDELDKLEEADRTAIYEVMEQGTISVAKA 455 Giardia lamblia...
XP_653372    245 IAPLAVSTNGRGATGVGL-TAAVVNDPDTNQ---RTLEAGAMVLADRGIVCVDEFDKMSIEDRAAMHEVMEQQTVTVQKA 320 Entamoeba histo...
3JA8_5       508 G-ITTVLNSRTSVLAAANPIYGRYDDLKSPGDNIDFQTTILSRFDMIFIVKDDHNEERDISIANHVINIH 576 Saccharomyces cerevisiae ...
Q8SRK9       359 G-IVSSLNTRCSVIAAINTRH-KYSFNKSISENIMVATPLISRFDLIFGLFDDRDGRSDLLIVDKILGRR 426 Encephalitozoon cuniculi
Q9CWV1       538 G-VVCSLPARTSIIAAANPVGGHYNKARTVSENLKMGSALLSRFDLVFILLDTPNEQHDHLLSEHVIAIR 606 house mouse
Q8SQX1       425 G-VICSVPTRATVIAATNPRHGHFDRGKTMAENIRFDPGLLSRFDLIFLLLDDLSEKESYMISGQILKKR 493 Encephalitozoon cuniculi
Q8TWR7       399 G-ITTTLNARCAVLAAANPEAGRWQGGHPI-EEINLDPALLSRFDVILFTRDEPDPEQDKLVAE---RMM 463 Methanopyrus kandleri
Q57809       490 GvIDAVLPARVAILAACNPRFGRFNPDLTVWEQINLPKELLDRFDLIFVIKDKIDKKKDEDIADFSIDNY 559 Methanocaldococcus jannas...
Q58884       422 G-INAKLPAECAILAACNPRWGRFNPEVSVAEQINIPAPLLSRFDLIFPIRDVSDKDKDKDIAEYIVDLH 490 Methanocaldococcus jannas...
EOA30066     349 G-LVASLSARTSVIAAANPVGGHYNRAKTVNENLKMSAALLSRFDLVFILLDKPDELLDKQVSEHIMSLH 417 Capsella rubella
XP_001706593 456 G-ITATLNARATVVAAANPKFSIWDPSISVASNINIPEALISRFDILFVIRDKIHEEEDMNLSLHVANLH 524 Giardia lamblia ATCC 50803
XP_653372    321 G-IHTALNARCSILAAANPSNGNYDVKKSPMENLYFPESLLSRFDLIFIILDSSTEELDRRLSQHVLKMH 389 Entamoeba histolytica HM-...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap