2O8F


Conserved Protein Domain Family
MutS_V

?
pfam00488: MutS_V 
Click on image for an interactive view with Cn3D
MutS domain V
This domain is found in proteins of the MutS family (DNA mismatch repair proteins) and is found associated with pfam01624, pfam05188, pfam05192 and pfam05190. The mutS family of proteins is named after the Salmonella typhimurium MutS protein involved in mismatch repair; other members of the family included the eukaryotic MSH 1,2,3, 4,5 and 6 proteins. These have various roles in DNA repair and recombination. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein. The aligned region corresponds with domain V of Thermus aquaticus MutS, which contains a Walker A motif, and is structurally similar to the ATPase domain of ABC transporters.
Statistics
?
PSSM-Id: 395392
View PSSM: pfam00488
Aligned: 29 rows
Threshold Bit Score: 257.894
Threshold Setting Gi: 308153466
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2O8F_A  665 HIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSL 744  human
P40965  630 QIITGCNMSGKSVYLKQVALICIMAQMGSGIPALYGSFPVFKRLHARV-CNDSMELTSSNFGFEMKEMAYFLDDINTETL 708  Saccharomyces cerev...
O13921  743 WLITGPNMAGKSTFLRQNAIISILAQIGSFVPASNARIGIVDQIFSRIGSADNLYQQKSTFMVEMMETSFILKNATRRSF 822  Schizosaccharomyces...
P57504  613 IIITGPNMGGKSTYMRQIALIVIMAGIGSFVPARYALIGSIDKIFTRIGSADDLSNGYSTFMMEMMEISNILHNATSNSL 692  Buchnera aphidicola...
O74502 1020 IVLTGPNMAGKSTLLRQVCIAVIMAQLGCWVPAKRASITPMTSIYTRLGANDDIMSARSTFMVELSETKKILDECGPKSL 1099 Schizosaccharomyces...
P43248  663 FIITGPNMGGKSTYIRSVGTAVLMAHIGAFVPCSLATISMVDSILGRVGASDNIIKGLSTFMVEMIETSGIIRTATDKSL 742  fruit fly
P25847  684 LIITGPNMGGKSTYIRQVGVISLMAQIGCFVPCEEAEIAIVDAILCRVGAGDSQLKGVSTFMVEILETASILKNASKNSL 763  Saccharomyces cerev...
O24617  662 QIVTGPNMGGKSTFIRQVGVIVLMAQVGSFVPCDKASISIRDCIFARVGAGDCQLRGVSTFMQEMLETASILKGASDKSL 741  thale cress
Q9SMV7  849 LLLTGPNMGGKSTLLRATCLAVIFAQLGCYVPCESCEISLVDTIFTRLGASDRIMTGESTFLVECTETASVLQNATQDSL 928  thale cress
O83348  622 ALITGPNMAGKSTFLRQTALICLIAQVGSFVPAEKAELTPVDRIFCRVGAADNLARGESTFLVEMSETAHILRAATRDSL 701  Treponema pallidum ...
2O8F_A  745 IIIDELGRGTSTYDGFGLAWAISEYIATKIGAFCMFATHFHELTALANQIPT-------VN--NLHVTAL---------- 805  human
P40965  709 LILDELGRGSSIADGFCVSLAVTEHLLR-TEATVFLSTHFQDIPKIMSKKPA-------VS--HLHMDAV---------- 768  Saccharomyces cerev...
O13921  823 VIMDEIGRGTTASDGIAIAYGCLKYLSTINHSRTLFATHAHQLTNLTKSFKN-------VEcyCTNLSID---------- 885  Schizosaccharomyces...
P57504  693 VLIDELGRGTSTNEGLSLAWSCSRYLININKSMTLLSTHFVELTKLEEKEKF-------VK--NFHFSAI---------- 753  Buchnera aphidicola...
O74502 1100 VILDELGRGTSTYDGHAIAYAVLHHLVSNIGCLGFFSTHYQSLCVDFMHHRQ-------VRlmQMAAAVD---------- 1162 Schizosaccharomyces...
P43248  743 VIIDELGRGTSTYEGCGIAWSIAEHLAKETKCFTLFATHFHEITKLAETLST-------VK--NCHMAAV---------- 803  fruit fly
P25847  764 IIVDELGRGTSTYDGFGLAWAIAEHIASKIGCFALFATHFHELTELSEKLPN-------VK--NMHVVAHieknl-keqk 833  Saccharomyces cerev...
O24617  742 IIIDELGRGTSTYDGFGLAWAICEHLVQVKRAPTLFATHFHELTALAQANSEvsgntvgVA--NFHVSAHi--------d 811  thale cress
Q9SMV7  929 VILDELGRGTSTFDGYAIAYSVFRHLVEKVQCRMLFATHYHPLTKEFASHPR-------VT--SKHMACAfksrsdyqpr 999  thale cress
O83348  702 VIMDEVGRGTATEDGLSIAQAVSEYLLHHVRAKTLFATHYHELSRLAH--PQ-------LE--HLKLDVL---------- 760  Treponema pallidum ...
2O8F_A  806 TTE-ETLTMLYQV-KKGVCDQSFGIHVAELANFPKHVIECAKQKALELE 852  human
P40965  769 LLNdNSVKMNYQLtQKSVAIENSGIRVVKKIFNPD-IIAEAYNIHSLLK 816  Saccharomyces cerevisiae S288C
O13921  886 RDD-HTFSFDYKL-KKGVNYQSHGLKVAEMAGIPKNVLLAAEEVLTLLP 932  Schizosaccharomyces pombe 972h-
P57504  754 KSD-LHIAFLYKI-KNGISKKSYGISVASLSGLPDSVLEDAEKKLIEIE 800  Buchnera aphidicola str. APS (Acyrthosiphon pisum)
O74502 1163 EKI-RRVTFLYKL-EDGICPKSYGMNVASMAGLPEKVIDAAEEKASELE 1209 Schizosaccharomyces pombe 972h-
P43248  804 ADA-DDFTLLYQV-RSGVMEKSFGIQVARLANFPEHVVQNAQEVYNEFE 850  fruit fly
P25847  834 HDD-EDITLLYKV-EPGISDQSFGIHVAEVVQFPEKIVKMAKRKANELD 880  Saccharomyces cerevisiae S288C
O24617  812 TES-RKLTMLYKV-EPGACDQSFGIHVAEFANFPESVVALAREKAAELE 858  thale cress
Q9SMV7 1000 GCD-QDLVFLYRL-TEGACPESYGLQVALMAGIPNQVVETASGAAQAMK 1046 thale cress
O83348  761 ETD-NTIVFLKKV-TPGSCGSSYGIYVARLAGLPESVLARACELLKQLQ 807  Treponema pallidum subsp. pallidum str. Nichols
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap