1WBD,2O8B,1NNE


Conserved Protein Domain Family
MutS_V

?
pfam00488: MutS_V 
Click on image for an interactive view with Cn3D
MutS domain V
This domain is found in proteins of the MutS family (DNA mismatch repair proteins) and is found associated with pfam01624, pfam05188, pfam05192 and pfam05190. The mutS family of proteins is named after the Salmonella typhimurium MutS protein involved in mismatch repair; other members of the family included the eukaryotic MSH 1,2,3, 4,5 and 6 proteins. These have various roles in DNA repair and recombination. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein. The aligned region corresponds with domain V of Thermus aquaticus MutS, which contains a Walker A motif, and is structurally similar to the ATPase domain of ABC transporters.
Statistics
?
PSSM-Id: 334107
View PSSM: pfam00488
Aligned: 34 rows
Threshold Bit Score: 253.273
Threshold Setting Gi: 308153466
Created: 14-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1WBD_A  610 LIITGPNMGGKSTYMRQTALIALMAYIGSYVPAQKVEIGPIDRIFTRVGAADDLASGRSTFMVEMTETANILHNATEYSL 689  Escherichia coli
O74502 1020 IVLTGPNMAGKSTLLRQVCIAVIMAQLGCWVPAKRASITPMTSIYTRLGANDDIMSARSTFMVELSETKKILDECGPKSL 1099 Schizosaccharomyces...
Q99MT2  698 LIITGPNMSGKSTYLKQIALCQIMAQIGSYVPAEYASFRIAAQIFTRISTDDDIETNSSTFMKEMKEIAYILHNANDKSL 777  house mouse
P40965  630 QIITGCNMSGKSVYLKQVALICIMAQMGSGIPALYGSFPVFKRLHARV-CNDSMELTSSNFGFEMKEMAYFLDDINTETL 708  Saccharomyces cerev...
P43248  663 FIITGPNMGGKSTYIRSVGTAVLMAHIGAFVPCSLATISMVDSILGRVGASDNIIKGLSTFMVEMIETSGIIRTATDKSL 742  fruit fly
P25847  684 LIITGPNMGGKSTYIRQVGVISLMAQIGCFVPCEEAEIAIVDAILCRVGAGDSQLKGVSTFMVEILETASILKNASKNSL 763  Saccharomyces cerev...
O24617  662 QIVTGPNMGGKSTFIRQVGVIVLMAQVGSFVPCDKASISIRDCIFARVGAGDCQLRGVSTFMQEMLETASILKGASDKSL 741  thale cress
P43246  665 HIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSL 744  human
Q9SMV7  849 LLLTGPNMGGKSTLLRATCLAVIFAQLGCYVPCESCEISLVDTIFTRLGASDRIMTGESTFLVECTETASVLQNATQDSL 928  thale cress
2O8B_A  665 HIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSL 744  human
1WBD_A  690 VLMDEIGRGTSTYDGLSLAWACAENLANKIKALTLFATHYFELTQLPEKMEG-------VA--NVHLDAL---------- 750  Escherichia coli
O74502 1100 VILDELGRGTSTYDGHAIAYAVLHHLVSNIGCLGFFSTHYQSLCVDFMHHRQ-------VRlmQMAAAVD---------- 1162 Schizosaccharomyces...
Q99MT2  778 ILIDELGRGTNTEEGIGISYAVCEHLLS-IKAFTLFTTHFLELCHLDALYLN-------VE--NMHFEVQhvk-----nt 842  house mouse
P40965  709 LILDELGRGSSIADGFCVSLAVTEHLLR-TEATVFLSTHFQDIPKIMSKKPA-------VS--HLHMDAV---------- 768  Saccharomyces cerev...
P43248  743 VIIDELGRGTSTYEGCGIAWSIAEHLAKETKCFTLFATHFHEITKLAETLST-------VK--NCHMAAV---------- 803  fruit fly
P25847  764 IIVDELGRGTSTYDGFGLAWAIAEHIASKIGCFALFATHFHELTELSEKLPN-------VK--NMHVVAHieknl-keqk 833  Saccharomyces cerev...
O24617  742 IIIDELGRGTSTYDGFGLAWAICEHLVQVKRAPTLFATHFHELTALAQANSEvsgntvgVA--NFHVSAHi--------d 811  thale cress
P43246  745 IIIDELGRGTSTYDGFGLAWAISEYIATKIGAFCMFATHFHELTALANQIPT-------VN--NLHVTAL---------- 805  human
Q9SMV7  929 VILDELGRGTSTFDGYAIAYSVFRHLVEKVQCRMLFATHYHPLTKEFASHPR-------VT--SKHMACAfksrsdyqpr 999  thale cress
2O8B_A  745 IIIDELGRGTSTYDGFGLAWAISEYIATKIGAFCMFATHFHELTALANQIPT-------VN--NLHVTAL---------- 805  human
1WBD_A  751 EHG-DTIAFMHSV-QDGAAS-KSYGLAVAALAGVPKEVIKRARQKLRELE 797  Escherichia coli
O74502 1163 EKI-RRVTFLYKL-EDGICP-KSYGMNVASMAGLPEKVIDAAEEKASELE 1209 Schizosaccharomyces pombe 972h-
Q99MT2  843 SRNkDAILYTYKL-SRGLTEeKNYGLKAAEASSLPSSIVLDARDITTQIT 891  house mouse
P40965  769 LLNdNSVKMNYQLtQKSVAI-ENSGIRVVKKIFNPD-IIAEAYNIHSLLK 816  Saccharomyces cerevisiae S288c
P43248  804 ADA-DDFTLLYQV-RSGVME-KSFGIQVARLANFPEHVVQNAQEVYNEFE 850  fruit fly
P25847  834 HDD-EDITLLYKV-EPGISD-QSFGIHVAEVVQFPEKIVKMAKRKANELD 880  Saccharomyces cerevisiae S288c
O24617  812 TES-RKLTMLYKV-EPGACD-QSFGIHVAEFANFPESVVALAREKAAELE 858  thale cress
P43246  806 TTE-ETLTMLYQV-KKGVCD-QSFGIHVAELANFPKHVIECAKQKALELE 852  human
Q9SMV7 1000 GCD-QDLVFLYRL-TEGACP-ESYGLQVALMAGIPNQVVETASGAAQAMK 1046 thale cress
2O8B_A  806 TTE-ETLTMLYQV-KKGVCD-QSFGIHVAELANFPKHVIECAKQKALELE 852  human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap