1WBD,2O8B,1NNE


Conserved Protein Domain Family
MutS_V

?
pfam00488: MutS_V 
Click on image for an interactive view with Cn3D
MutS domain V
This domain is found in proteins of the MutS family (DNA mismatch repair proteins) and is found associated with pfam01624, pfam05188, pfam05192 and pfam05190. The mutS family of proteins is named after the Salmonella typhimurium MutS protein involved in mismatch repair; other members of the family included the eukaryotic MSH 1,2,3, 4,5 and 6 proteins. These have various roles in DNA repair and recombination. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein. The aligned region corresponds with domain V of Thermus aquaticus MutS, which contains a Walker A motif, and is structurally similar to the ATPase domain of ABC transporters.
Statistics
?
PSSM-Id: 334107
View PSSM: pfam00488
Aligned: 34 rows
Threshold Bit Score: 253.273
Threshold Setting Gi: 308153466
Created: 14-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1WBD_A        610 LIITGPNMGGKSTYMRQTALIALMAYIGSYVPAQKVEIGPIDRIFTRVGAADDLASGRSTFMVEMTETANILHNATEYSL 689
gi 39931686  1020 IVLTGPNMAGKSTLLRQVCIAVIMAQLGCWVPAKRASITPMTSIYTRLGANDDIMSARSTFMVELSETKKILDECGPKSL 1099
gi 30580447   698 LIITGPNMSGKSTYLKQIALCQIMAQIGSYVPAEYASFRIAAQIFTRISTDDDIETNSSTFMKEMKEIAYILHNANDKSL 777
gi 308153466  630 QIITGCNMSGKSVYLKQVALICIMAQMGSGIPALYGSFPVFKRLHARV-CNDSMELTSSNFGFEMKEMAYFLDDINTETL 708
gi 83304687   663 FIITGPNMGGKSTYIRSVGTAVLMAHIGAFVPCSLATISMVDSILGRVGASDNIIKGLSTFMVEMIETSGIIRTATDKSL 742
gi 2506880    684 LIITGPNMGGKSTYIRQVGVISLMAQIGCFVPCEEAEIAIVDAILCRVGAGDSQLKGVSTFMVEILETASILKNASKNSL 763
gi 3914056    662 QIVTGPNMGGKSTFIRQVGVIVLMAQVGSFVPCDKASISIRDCIFARVGAGDCQLRGVSTFMQEMLETASILKGASDKSL 741
gi 1171032    665 HIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSL 744
gi 12643849   849 LLLTGPNMGGKSTLLRATCLAVIFAQLGCYVPCESCEISLVDTIFTRLGASDRIMTGESTFLVECTETASVLQNATQDSL 928
2O8B_A        665 HIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSL 744
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1WBD_A        690 VLMDEIGRGTSTYDGLSLAWACAENLANKIKALTLFATHYFELTQLPEKMEG-------VA--NVHLDAL---------- 750
gi 39931686  1100 VILDELGRGTSTYDGHAIAYAVLHHLVSNIGCLGFFSTHYQSLCVDFMHHRQ-------VRlmQMAAAVD---------- 1162
gi 30580447   778 ILIDELGRGTNTEEGIGISYAVCEHLLS-IKAFTLFTTHFLELCHLDALYLN-------VE--NMHFEVQhvk-----nt 842
gi 308153466  709 LILDELGRGSSIADGFCVSLAVTEHLLR-TEATVFLSTHFQDIPKIMSKKPA-------VS--HLHMDAV---------- 768
gi 83304687   743 VIIDELGRGTSTYEGCGIAWSIAEHLAKETKCFTLFATHFHEITKLAETLST-------VK--NCHMAAV---------- 803
gi 2506880    764 IIVDELGRGTSTYDGFGLAWAIAEHIASKIGCFALFATHFHELTELSEKLPN-------VK--NMHVVAHieknl-keqk 833
gi 3914056    742 IIIDELGRGTSTYDGFGLAWAICEHLVQVKRAPTLFATHFHELTALAQANSEvsgntvgVA--NFHVSAHi--------d 811
gi 1171032    745 IIIDELGRGTSTYDGFGLAWAISEYIATKIGAFCMFATHFHELTALANQIPT-------VN--NLHVTAL---------- 805
gi 12643849   929 VILDELGRGTSTFDGYAIAYSVFRHLVEKVQCRMLFATHYHPLTKEFASHPR-------VT--SKHMACAfksrsdyqpr 999
2O8B_A        745 IIIDELGRGTSTYDGFGLAWAISEYIATKIGAFCMFATHFHELTALANQIPT-------VN--NLHVTAL---------- 805
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|
1WBD_A        751 EHG-DTIAFMHSV-QDGAAS-KSYGLAVAALAGVPKEVIKRARQKLRELE 797
gi 39931686  1163 EKI-RRVTFLYKL-EDGICP-KSYGMNVASMAGLPEKVIDAAEEKASELE 1209
gi 30580447   843 SRNkDAILYTYKL-SRGLTEeKNYGLKAAEASSLPSSIVLDARDITTQIT 891
gi 308153466  769 LLNdNSVKMNYQLtQKSVAI-ENSGIRVVKKIFNPD-IIAEAYNIHSLLK 816
gi 83304687   804 ADA-DDFTLLYQV-RSGVME-KSFGIQVARLANFPEHVVQNAQEVYNEFE 850
gi 2506880    834 HDD-EDITLLYKV-EPGISD-QSFGIHVAEVVQFPEKIVKMAKRKANELD 880
gi 3914056    812 TES-RKLTMLYKV-EPGACD-QSFGIHVAEFANFPESVVALAREKAAELE 858
gi 1171032    806 TTE-ETLTMLYQV-KKGVCD-QSFGIHVAELANFPKHVIECAKQKALELE 852
gi 12643849  1000 GCD-QDLVFLYRL-TEGACP-ESYGLQVALMAGIPNQVVETASGAAQAMK 1046
2O8B_A        806 TTE-ETLTMLYQV-KKGVCD-QSFGIHVAELANFPKHVIECAKQKALELE 852
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap