1A7J


Conserved Protein Domain Family
PRK

?
pfam00485: PRK 
Click on image for an interactive view with Cn3D
Phosphoribulokinase / Uridine kinase family
This family matches three types of P-loop containing kinases: phosphoribulokinases, uridine kinases and bacterial pantothenate kinases(CoaA). Arabidopsis and other organisms have a dual uridine kinase/uracil phosphoribosyltransferase protein where the N-terminal region consists of a UK domain and the C-terminal region of a UPRT domain.
Statistics
?
PSSM-Id: 278888
View PSSM: pfam00485
Aligned: 11 rows
Threshold Bit Score: 248.083
Threshold Setting Gi: 137110
Created: 11-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1A7J_A         7 IISVTGSSGAGTSTVKHTFDQIFRREGVKAVSI-----EGDAFHRFNRADMKAELDRRYAAGDATFSHFSYEANELKELE 81
gi 123612781   7 IISITGSSGAGTTSVKRTFEQIFRREKVVAAYI-----EGDAFHRYNRAEMRTRMAEESDKGNRHFSHFSPETNLFAELE 81
gi 125574      7 IIAITGSSGAGTTSVTRTFENIFCREGVKSVVI-----EGDSFHRYDRAEMKVKMAEAERTGNMNFSHFGAENNLFGDLE 81
gi 84029530    7 VIAVTGSSGAGTTTTSLAFRKIFAQLNLHAAEV-----EGDSFHRYTRPEMDMAIRKARDAG-RHISYFGPEANDFGLLE 80
gi 125576     52 VIGLAADSGCGKSTFMRRLTSVFGGAAKPPKGGnpdsnTLISDTTTVICLDDYHSLDRYGRKEQKVTALDPRANDFDLMY 131
gi 585368     10 LIGVAGDSGCGKSTFLRRLTDLFG-----------------EEFMTVICLDDYHSLDRQGRKAAGVTALDPRANNFDLMY 72
gi 74963915   66 VIGVCGGSASGKTTVAEKIVERLGIPWVT-------------ILSMDSFYKVLTPEEIKAAHESRYNFDGPNAFDFDLLY 132
gi 137110     58 IIGIGGASGSGKTSVAAKIVSSIN---VP----------WTVLISLDNFYNPLGPEDRARAFKNEYDFDEPNAINLDLAY 124
gi 74676080   23 FIGIAGPSGSGKTSVAQLIVKALN---LP----------HVVILSLDSFYKSLNAEQKKRAFNNDYDFDSPEAIDWDLLF 89
gi 159471788  38 VIGLAADSGCGKSTFMRRMTSIFGGVPKPPAGGnpdsnTLISDMTTVICLDDYHCLDRNGRKVKGVTALAPEAQNFDLMY 117
gi 123590720   7 IISVTGSSGAGTSTVKHTFDQIFRREGVKAVSI-----EGDAFHRFNRADMKAELDRRYAAGDATFSHFSYEANELKELE 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1A7J_A        82 RVFREYGETGQGRTRTYVHDDAEAARtgvapgnftDWRDFDSDSHLLFYEGLHGAVVNSevnIAGLADLKIGVVPVINLE 161
gi 123612781  82 SVFRSYGETGTGTTRYYVHDDTESALhgvppgtftDWQPLPENSDLLFYEGLHGAVVTDkvnVAQYADLKIGVVPVINLE 161
gi 125574     82 SLFRSYAESGTGMRRRYLHSTEEAAPfgqqpgtftAWEPLPADTDLLFYEGLHGGVVTDevnVAQYPNLLIGVVPVINLE 161
gi 84029530   81 QTFIEYGQSGKGKSRKYLHTYDEAVPwnqvpgtftPWQPLPEPTDVLFYEGLHGGVVTPqhnVAQHVDLLVGVVPIVNLE 160
gi 125576    132 EQVKALKNGIAVEKPIYNHVTGLLDP-----------PELIQPPKILVIEGLHPMFDER---VRDLLDFSIYLDISNEVK 197
gi 585368     73 EQIKTLKSGQSIMKPIYNHETGLLDP-----------PEKVEPNKVVVIEGLHPLYDER---VRELVDFGVYLDISEEVK 138
gi 74963915  133 EVLKRLREGKSVDVPVYDFNTHSRDP----------NSKMMYGADVLIFEGILAFHDER---IKNLMDMKVFVDTDGDLR 199
gi 137110    125 KCILNLKEGKRTNIPVYSFVHHNRVP---------DKNIVIYGASVVVIEGIYALYDRR---LLDLMDLKIYVDADLDVC 192
gi 74676080   90 VKLLELKQGRKVDIPIYSFNEHNRLP----------ETNTLFGASIIILEGIFALYDEK---IRSLLDVSVFLDTDSDVC 156
gi 159471788 118 NQVKALKEGKSVDKPIYNHVSGLIDA-----------PEKIESPPILVIEGLHPFYDKR---VAELLDFKIYLDISDDIK 183
gi 123590720  82 RVFREYGETGQGRTRTYVHDDAEAARtgvapgnftDWRDFDSDSHLLFYEGLHGAVVNSevnIAGLADLKIGVVPVINLE 161
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*
1A7J_A       162 WIQKIHRDRATRGYTTEAVTDVIL-RRMHAYVHCIVPQFSQTDINFQRVPVVDTS 215
gi 123612781 162 WIQKLHRDRSARGYSTEAVTDTIL-RRMPDYVNYICPQFAETDINFQRVPTVDTS 215
gi 125574    162 WIQKLWRDKKQRGYSTEAVTDTIL-RRMPDYVNYICPQFSRTHVNFQRVPCVDTS 215
gi 84029530  161 WIQKLIRDTSERGHSREAVMDSVV-RSMEDYINYITPQFSRTHLNFQRVPTVDTS 214
gi 125576    198 FAWKIQRDMAERGHSLESIKASIE-ARKPDFDAFIDPQKQYADAVIEVLPTTLIP 251
gi 585368    139 INWKIQRDMAERGHTYEDILASIN-ARKPDFTAYIEPQKQYADVVIQVLPTRLIE 192
gi 74963915  200 LARRIVRDVTDRGRDIDGIMEQYFtFVKPAFDKYIAPCMDSADLIVPRGGENDVA 254
gi 137110    193 LARRLSRDIVSRGRDLDGCIQQWEkFVKPNAVKFVKPTMKNADAIIPSMSDNATA 247
gi 74676080  157 LSRRLNRDINYRGRDIVGVLEQYNkFVKPSYENFVRRQLSYTDLIVPRGRDNKLA 211
gi 159471788 184 FAWKIQRDMAERGHSLESIKSSIA-ARKPDFDAYIDPQKKDADMIIQVLPTQLVp 237
gi 123590720 162 WIQKIHRDRATRGYTTEAVTDVIL-RRMHAYVHCIVPQFSQTDINFQRVPVVDTS 215
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap