1A7J


Conserved Protein Domain Family
PRK

?
pfam00485: PRK 
Click on image for an interactive view with Cn3D
Phosphoribulokinase / Uridine kinase family
This family matches three types of P-loop containing kinases: phosphoribulokinases, uridine kinases and bacterial pantothenate kinases(CoaA). Arabidopsis and other organisms have a dual uridine kinase/uracil phosphoribosyltransferase protein where the N-terminal region consists of a UK domain and the C-terminal region of a UPRT domain.
Statistics
?
PSSM-Id: 278888
View PSSM: pfam00485
Aligned: 11 rows
Threshold Bit Score: 248.083
Threshold Setting Gi: 137110
Created: 11-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1A7J_A         7 IISVTGSSGAGTSTVKHTFDQIFRREGVKAVSI-----EGDAFHRFNRADMKAELDRRYAAGDATFSHFSYEANELKELE 81  Rhodobacter sph...
Q3SP45         7 IISITGSSGAGTTSVKRTFEQIFRREKVVAAYI-----EGDAFHRYNRAEMRTRMAEESDKGNRHFSHFSPETNLFAELE 81  Nitrobacter win...
P19924         7 IIAITGSSGAGTTSVTRTFENIFCREGVKSVVI-----EGDSFHRYDRAEMKVKMAEAERTGNMNFSHFGAENNLFGDLE 81  Ralstonia eutro...
P0AEX5         7 VIAVTGSSGAGTTTTSLAFRKIFAQLNLHAAEV-----EGDSFHRYTRPEMDMAIRKARDAG-RHISYFGPEANDFGLLE 80  Escherichia col...
P25697        52 VIGLAADSGCGKSTFMRRLTSVFGGAAKPPKGGnpdsnTLISDTTTVICLDDYHSLDRYGRKEQKVTALDPRANDFDLMY 131 thale cress
P37101        10 LIGVAGDSGCGKSTFLRRLTDLFG-----------------EEFMTVICLDDYHSLDRQGRKAAGVTALDPRANNFDLMY 72  Synechocystis s...
Q19583        66 VIGVCGGSASGKTTVAEKIVERLGIPWVT-------------ILSMDSFYKVLTPEEIKAAHESRYNFDGPNAFDFDLLY 132 Caenorhabditis ...
P27515        58 IIGIGGASGSGKTSVAAKIVSSIN---VP----------WTVLISLDNFYNPLGPEDRARAFKNEYDFDEPNAINLDLAY 124 Saccharomyces c...
O74427        23 FIGIAGPSGSGKTSVAQLIVKALN---LP----------HVVILSLDSFYKSLNAEQKKRAFNNDYDFDSPEAIDWDLLF 89  Schizosaccharom...
XP_001694038  38 VIGLAADSGCGKSTFMRRMTSIFGGVPKPPAGGnpdsnTLISDMTTVICLDDYHCLDRNGRKVKGVTALAPEAQNFDLMY 117 Chlamydomonas r...
Q3IYC0         7 IISVTGSSGAGTSTVKHTFDQIFRREGVKAVSI-----EGDAFHRFNRADMKAELDRRYAAGDATFSHFSYEANELKELE 81  Rhodobacter sph...
1A7J_A        82 RVFREYGETGQGRTRTYVHDDAEAARtgvapgnftDWRDFDSDSHLLFYEGLHGAVVNSevnIAGLADLKIGVVPVINLE 161 Rhodobacter sph...
Q3SP45        82 SVFRSYGETGTGTTRYYVHDDTESALhgvppgtftDWQPLPENSDLLFYEGLHGAVVTDkvnVAQYADLKIGVVPVINLE 161 Nitrobacter win...
P19924        82 SLFRSYAESGTGMRRRYLHSTEEAAPfgqqpgtftAWEPLPADTDLLFYEGLHGGVVTDevnVAQYPNLLIGVVPVINLE 161 Ralstonia eutro...
P0AEX5        81 QTFIEYGQSGKGKSRKYLHTYDEAVPwnqvpgtftPWQPLPEPTDVLFYEGLHGGVVTPqhnVAQHVDLLVGVVPIVNLE 160 Escherichia col...
P25697       132 EQVKALKNGIAVEKPIYNHVTGLLDP-----------PELIQPPKILVIEGLHPMFDER---VRDLLDFSIYLDISNEVK 197 thale cress
P37101        73 EQIKTLKSGQSIMKPIYNHETGLLDP-----------PEKVEPNKVVVIEGLHPLYDER---VRELVDFGVYLDISEEVK 138 Synechocystis s...
Q19583       133 EVLKRLREGKSVDVPVYDFNTHSRDP----------NSKMMYGADVLIFEGILAFHDER---IKNLMDMKVFVDTDGDLR 199 Caenorhabditis ...
P27515       125 KCILNLKEGKRTNIPVYSFVHHNRVP---------DKNIVIYGASVVVIEGIYALYDRR---LLDLMDLKIYVDADLDVC 192 Saccharomyces c...
O74427        90 VKLLELKQGRKVDIPIYSFNEHNRLP----------ETNTLFGASIIILEGIFALYDEK---IRSLLDVSVFLDTDSDVC 156 Schizosaccharom...
XP_001694038 118 NQVKALKEGKSVDKPIYNHVSGLIDA-----------PEKIESPPILVIEGLHPFYDKR---VAELLDFKIYLDISDDIK 183 Chlamydomonas r...
Q3IYC0        82 RVFREYGETGQGRTRTYVHDDAEAARtgvapgnftDWRDFDSDSHLLFYEGLHGAVVNSevnIAGLADLKIGVVPVINLE 161 Rhodobacter sph...
1A7J_A       162 WIQKIHRDRATRGYTTEAVTDVIL-RRMHAYVHCIVPQFSQTDINFQRVPVVDTS 215 Rhodobacter sphaeroides
Q3SP45       162 WIQKLHRDRSARGYSTEAVTDTIL-RRMPDYVNYICPQFAETDINFQRVPTVDTS 215 Nitrobacter winogradskyi Nb-255
P19924       162 WIQKLWRDKKQRGYSTEAVTDTIL-RRMPDYVNYICPQFSRTHVNFQRVPCVDTS 215 Ralstonia eutropha H16
P0AEX5       161 WIQKLIRDTSERGHSREAVMDSVV-RSMEDYINYITPQFSRTHLNFQRVPTVDTS 214 Escherichia coli K-12
P25697       198 FAWKIQRDMAERGHSLESIKASIE-ARKPDFDAFIDPQKQYADAVIEVLPTTLIP 251 thale cress
P37101       139 INWKIQRDMAERGHTYEDILASIN-ARKPDFTAYIEPQKQYADVVIQVLPTRLIE 192 Synechocystis sp. PCC 6803 substr. Kazusa
Q19583       200 LARRIVRDVTDRGRDIDGIMEQYFtFVKPAFDKYIAPCMDSADLIVPRGGENDVA 254 Caenorhabditis elegans
P27515       193 LARRLSRDIVSRGRDLDGCIQQWEkFVKPNAVKFVKPTMKNADAIIPSMSDNATA 247 Saccharomyces cerevisiae S288c
O74427       157 LSRRLNRDINYRGRDIVGVLEQYNkFVKPSYENFVRRQLSYTDLIVPRGRDNKLA 211 Schizosaccharomyces pombe 972h-
XP_001694038 184 FAWKIQRDMAERGHSLESIKSSIA-ARKPDFDAYIDPQKKDADMIIQVLPTQLVp 237 Chlamydomonas reinhardtii
Q3IYC0       162 WIQKIHRDRATRGYTTEAVTDVIL-RRMHAYVHCIVPQFSQTDINFQRVPVVDTS 215 Rhodobacter sphaeroides 2.4.1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap