2XI1


Conserved Protein Domain Family
F-protein

?
pfam00469: F-protein 
Click on image for an interactive view with Cn3D
Negative factor, (F-Protein) or Nef
Nef protein accelerates virulent progression of AIDS by its interaction with cellular proteins involved in signal transduction and host cell activation. Nef has been shown to bind specifically to a subset of the Src kinase family.
Statistics
?
PSSM-Id: 306876
View PSSM: pfam00469
Aligned: 21 rows
Threshold Bit Score: 273.102
Threshold Setting Gi: 128055
Created: 14-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2XI1_B   2 GGKWSKSSIVGWPAIRERLRRAQPAAERRRAQPAAE---------GVGAASQDLGRHGALTSSN---------------- 56  Human immunodeficienc...
P20868   2 GASGSKKRSEPSRGLRERLLQTPGEASGGHWDKLGGeylqsqegsGRGQKSPSCEGRRYQQGDFmntpwrap-aegekgs 80  Human immunodeficienc...
P12447   2 GASGSKKRSRPSRGLQERLLRARGGACGGLWDESEGgysqfhegsGREQKLPSCEGQRYQQGDFmntpwrtpatekekes 81  Human immunodeficienc...
P04600   2 GASGSKKHSRPPRGLQERLLRARAGACGGYWNESGGeysrfqegsDREQKSPSCEGRQYQQGDFmntpwkdpaaereknl 81  Human immunodeficienc...
P05862   2 GGAISKKRSKPPRDLRQRLLRARGENYGRLFKGVEDgssqslgglDKGLSSLSCEGQKYNQGEYmntpwrnpaeerkklp 81  Simian immunodeficien...
P12482   2 GGAISKKQYKRGGNLRERLLQARGETYGRLWEGLEEgysqslgasGKGLSSLSCEPQKYSEGQYmntpwrnpateraklg 81  Simian immunodeficien...
P15829   2 GSAGSKKRSERQQGLREKLLRVPERPYGRLSGERREqssrspgesDKDLNSPSCEGQNARGAEG---------------- 65  Human immunodeficienc...
Q02840   2 GSSNSKRQQQGLLKLWRGLRGKPGADWVLLSDPLIGqsstvqeecGKALKKSWGKGK--MTPDG---------------- 63  Simian immunodeficien...
P18092   2 GASGSKKLSKHSRGLRERLLRARGDGYGKQRDASGGeysqfqeesGREQNSPSCEGQQYQQGEYmnspwrnpaterqkdl 81  Human immunodeficienc...
P18038   2 GASGSKKHSKHSQRLRERLLRAHGGGYVQQCNASGGeysqsqegsGKGQKSPSCEGQQYRQGDFmntpwrtpaiegqkkl 81  Human immunodeficienc...
2XI1_B  57 TDTTNAD-------EEEEVG-FPVRPQVPLRPMTYKGAVDLSFFLKEKGGLEGLVYSQKRKEILDLWVYHTQGYFPDWQC 128 Human immunodeficienc...
P20868  81 YKQQNMDdvd--sdDDDLVG-VPVTPRVPLREMTYRLARDMSHLIKEKGGLEGLYYSDRRRRVLDIYLEKEEGIIGDWQN 157 Human immunodeficienc...
P12447  82 YRQQNMDdvd--sdDDDLVG-VSDTSRVPLRAMTYRMAVDMSDLIKDKGGLEGMYYSERRHRILDIYLEKEEGIIPDWQN 158 Human immunodeficienc...
P04600  82 YRQQNMDdvd--sdDDDQVR-VSVTPKVPLRPMTHRLAIDMSHLIKTRGGLEGMFYSERRHKILNIYLEKEEGIIADWQN 158 Human immunodeficienc...
P05862  82 YRKQNIDdid--eeDDDLVG-IPVEARVPLRTMSYKLAIDMSHFIKEKGGLEGIYYSARRHRILDIYLEKEEGIIPDWQI 158 Simian immunodeficien...
P12482  82 YRQQNMDdvd--deDDDLIG-VSVHPRVPLRAMTYKLAIDMSHFIKEKGGLEGIYYNERRHRILDMYLEKEEGIIPDWQN 158 Simian immunodeficien...
P15829  66 GGQQDADes----dEDDEVGaICKTPIVPLRPMTYKLAVDMSHFIKEQGGLEGMYYSERRHRILDTYFENEEGIVSGWQN 141 Human immunodeficienc...
Q02840  64 RRLQEGDtfdewddDEEEVG-FPVQPRVPLRQMTYKLAVDFSHFLKSKGGLDGIYYSERREKILNLYALNEWGIIDDWQA 142 Simian immunodeficien...
P18092  82 YRQQNMDdvd--sdDDDLIG-VPVTPRVPRREMTYKLAIDMSHFIKEKGGLQGMFYSRRRHRILDIYLEKEEGIIPDWQN 158 Human immunodeficienc...
P18038  82 YKQQNMDdid--ssDDDLVG-VPVTPRVPLRAMTYKLAVDMSHFIKKR-GLDGMFYSRDRHRILDLYLEKEEGIIPDWQN 157 Human immunodeficienc...
2XI1_B 129 YTPGPGVRYPLTFGWCFKLVPVDPGEVEEatEGENNCLLHPICQHGMDD--DHREVLKWKFDSHLAHTHMARELHPEFYK 206 Human immunodeficienc...
P20868 158 YTHGPGVRYPKFFGWLWKLVPVDVPQEGD--DSETHCLVHPAQTSRFDD--PHGETLVWRFDPTLAFSYEAFIRYPEEFG 233 Human immunodeficienc...
P12447 159 YTHGLGVRYPMFFGWLWKLVPVTVPQEGE--DTETLCLMHSAQVSRFDD--PHGETLVWKFDPMLAHEYTTFILYPEEFG 234 Human immunodeficienc...
P04600 159 YTHGPGVRYPMFFGWLWKLVPVDVPQEGE--DTETHCLVHPAQTSKFDD--PHGETLVWEFDPLLAYSYEAFIRYPEEFG 234 Human immunodeficienc...
P05862 159 HS-GPGIRYLKMFGWLWKLIPVNVSDEAQ--EDEEHYLVHPAQTSQWDD--PWGEVLAWKFDPTLAYTYEAYIRYPEEFG 233 Simian immunodeficien...
P12482 159 YTSGPGIRYPMHYGWLWKLVPVDVSDEAQ--EDETHCLVHPAQTYQWDD--PWGEVLAWKFDPELAYSYKAFIKYPEEFG 234 Simian immunodeficien...
P15829 142 YTHGPGIRYPKYFGWLWKLVPVEVPAATRe-EEETHCLMHPAQISSWDD--IHGETLIWQFDSLLAYDYVAFNRFPEEFG 218 Human immunodeficienc...
Q02840 143 YSPGPGIRYPRVFGFCFKLVPVDLHEEAR--NCERHCLMHPAQMGEDPDgiDHGEVLVWKFDPKLAVEYRP--DMFKDMH 218 Simian immunodeficien...
P18092 159 YTHGPGVRYPMYFGWLWKLVSVELSQEAE--EDEANCLVHPAQTSRHDD--EHGETLVWQFDSMLAYNYKAFTLYPEEFG 234 Human immunodeficienc...
P18038 158 YTHGPGVRYPMCFGWLWKLVPVDVSQEAE--DDETNYLTHPAQTSRHDD--EHGETLLWRFDPTLAYDYKAFILHPEEFG 233 Human immunodeficienc...
2XI1_B 207 N 207 Human immunodeficiency virus type 1 (BH5 ISOLATE)
P20868 234 Y 234 Human immunodeficiency virus type 2 (ISOLATE ST)
P12447 235 H 235 Human immunodeficiency virus type 2 (ISOLATE SBLISY)
P04600 235 H 235 Human immunodeficiency virus type 2 (ISOLATE ROD)
P05862 234 S 234 Simian immunodeficiency virus (MM142-83 ISOLATE)
P12482 235 S 235 Simian immunodeficiency virus (F236/SMH4 ISOLATE) (SOOTY MANGABEY)
P15829 219 Y 219 Human immunodeficiency virus type 2 (ISOLATE D205,7)
Q02840 219 E 219 Simian immunodeficiency virus (isolate AGM / clone GRI-1)
P18092 235 H 235 Human immunodeficiency virus type 2 (ISOLATE BEN)
P18038 234 H 234 Human immunodeficiency virus type 2 (ISOLATE GHANA-1)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap