1DQU


Conserved Protein Domain Family
ICL

?
pfam00463: ICL 
Click on image for an interactive view with Cn3D
Isocitrate lyase family
Statistics
?
Aligned: 7 rows
Threshold Bit Score: 998.964
Threshold Setting Gi: 1168289
Created: 22-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1DQU_A        14 EVAAVKNWWKDSRWRYTKRPFTAEQIVAKRGNLK-IEYPSNVQAKKLWGILERNFKNKEASFTYGCLDPTMVTQMAKYLD 92  Aspergillus nid...
P28298        14 EVAAVKNWWKDSRWRYTKRPFTAEQIVAKRGNLK-IEYPSNVQAKKLWGILERNFKNKEASFTYGCLDPTMVTQMAKYLD 92  Aspergillus nid...
P28299        23 EVEEVKKWWSDSRWRQTKRPFTAEQIVSKRGNLK-IEYASNAQAKKLWKILEDRFAKRDASYTYGCLEPTMVTQMAKYLD 101 Neurospora cras...
P41555        10 EVEEIKKWWSSPRWKHTKRVYSPEDIASRRGTIK-VPQASSQQADKLFKLLQEHEKNHTASFTYGALDPVQVTQMAKYLD 88  Yarrowia lipoly...
P28240        22 DAAEIEKWWSDSRWSKTKRNYSARDIAVRRGTFPpIEYPSSVMARKLFKVLEKHHNEGTVSKTFGALDPVQISQMAKYLD 101 Saccharomyces c...
XP_002550404  18 EVAEIKKWWSEPRWRKTKRIYSAEDIAKKRGSLK-ISYPSSQQADKLFKLLEQHDAEKSVSFTFGALDPIHVAQMAKYLD 96  Candida tropica...
P45456         3 EVAEVQAWWNSERFRLTKRPYTARDVVSLRGNLR-QTYASNEMAKKLWRLLKNHQANGTASRTFGALDPVQVTQMAKHLD 81  soybean
1DQU_A        93 TVYVSGWQSSSTASSTDEPSPDLADYPMNTVPNKVNHLWMAQLFHDRKQREERMTTPKDQ--RHKV-ANVDYLRPIIADA 169 Aspergillus nid...
P28298        93 TVYVSGWQSSSTASSTDEPSPDLADYPMNTVPNKVNHLWMAQLFHDRKQREERMTTPKDQ--RHKV-ANVDYLRPIIADA 169 Aspergillus nid...
P28299       102 TVYVSGWQSSSTASSSDEPGPDLADYPYTTVPNKVGHLFMAQLFHDRKQRQERLSVPKDQ--REKL-ANIDYLRPIVADA 178 Neurospora cras...
P41555        89 SIYVSGWQSSSTASTSNEPSPDLADYPMDTVPNKVEHLWFAQLFHDRKQNEERLSLPESE--RSKLpAPVDYLRPIIADA 166 Yarrowia lipoly...
P28240       102 TIYISGWQCSSTASTSNEPGPDLADYPMDTVPNKVEHLFKAQLFHDRKQLEARSKAKSQEelDEMG-APIDYLTPIVADA 180 Saccharomyces c...
XP_002550404  97 SIYVSGWQCSSTASTSNEPSPDLADYPMDTVPNKVEHLWFAQLFHDRKQREERLNMTKEE--RAKT-PYIDFLRPIIADA 173 Candida tropica...
P45456        82 TIYVSGWQCSATHTTSNEPGPDLADYPYDTVPNKVEHLFFAQQYHDRKQKEERMRMSREE--RART-PYVDYLRPIIADG 158 soybean
1DQU_A       170 DTGHGGLTAVMKLTKLFVERGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINRLVAIRAQADIMGTDLLAIARTDSEAA 249 Aspergillus nid...
P28298       170 DTGHGGLTAVMKLTKLFVERGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINRLVAIRAQADIMGTDLLAIARTDSEAA 249 Aspergillus nid...
P28299       179 DTGHGGLTAVMKLTKLFIEKGAAGIHIEDQAPGTKKCGHMAGKVLVPIQEHINRLVAIRAQADIMGSDLLCIARTDAEAA 258 Neurospora cras...
P41555       167 DTGHGGLTAVVKLTKMFIERGAAGIHIEDQAPGTKKCGHMAGKVLVPIQEHINRLIAIRASADIFGSDLLAIARTDSEAA 246 Yarrowia lipoly...
P28240       181 DAGHGGLTAVFKLTKMFIERGAAGIHMEDQTSTNKKCGHMAGRCVIPVQEHVNRLVTIRMCADIMHSDLIVVARTDSEAA 260 Saccharomyces c...
XP_002550404 174 DTGHGGITAIIKLTKLFIERGAAGIHIEDQAPGTKKCGHMAGKVLVPVQEHINRLVAIRASADIFGSNLLAVARTDSEAA 253 Candida tropica...
P45456       159 DTGFGGTTATVKLCKLFVERGAAGIHIEDQSSVTKKCGHMAGKVLVAISEHINRLVAARLQFDVMGVETVLVARTDAEAA 238 soybean
1DQU_A       250 TLITSTIDHRDHPFIIGSTNPDI--QPLNDLMVMAEQAGKNGAELQAIEDEWLAKAGLKLFNDAVVDAINNSP---LPNK 324 Aspergillus nid...
P28298       250 TLITSTIDHRDHPFIIGSTNPDI--QPLNDLMVMAEQAGKNGAELQAIEDEWLAKAGLKLFNDAVVDAINNSP---LPNK 324 Aspergillus nid...
P28299       259 TLITTTIDPRDHAFILGCTNPDL--EPLADLMMKAEAEGKTGAQLQAIEDDWLAKADLKRFDEAVLDVIAKGK---FSNA 333 Neurospora cras...
P41555       247 TLITSSIDYRDHYFIAGATNKDA--GHLVDVMVAAELEGKQGAALQAVEDEWNRKAGVKLFHEAFADEVNAGS---YSNK 321 Yarrowia lipoly...
P28240       261 TLISSTIDTRDHYFIVGATNPNI--EPFAEVLNDAIMSGASGQELADIEQKWCRDAGLKLFHEAVIDEIERSA---LSNK 335 Saccharomyces c...
XP_002550404 254 TLITSTIDHRDHYFIIGATNPEA--GDLSALMSEAEAKGIYGDELAAIETEWTKKAGLKLFHEAVIDEIKAGN---YSNK 328 Candida tropica...
P45456       239 NLIQSNIDTRDHQFILGVTNPNLkgKSLATLMQQGMAAGKNGAELQALEDEWLSKAQLKTLSEAVVEAIERQNnigEEEK 318 soybean
1DQU_A       325 KAAIEKYLTQSKGKSNL---EARAIAKEIAGTDIYFDWEAPRTREGYYRYQGGTQCAINRAVAYAPFADLIWMESKLPDY 401 Aspergillus nid...
P28298       325 KAAIEKYLTQSKGKSNL---EARAIAKEIAGTDIYFDWEAPRTREGYYRYQGGTQCAINRAVAYAPFADLIWMESKLPDY 401 Aspergillus nid...
P28299       334 KDLAAKYQAAVK-GKQIsnrEARAIARQLLGQEIFFDWESPRTREGYYRLKGGCDCSINRAISYAPYCDAIWMESKLPDY 412 Neurospora cras...
P41555       322 AELIAEFNKKVTPLSNTpalEARALAARLLGKDIYFNWEAARVREGYYRYQGGTQCAVNRGIAYAPYADLIWMESKLPDY 401 Yarrowia lipoly...
P28240       336 QELIKKFTSKVGPLTETshrEAKKLAKEILGHEIFFDWELPRVREGLYRYRGGTQCSIMRARAFAPYADLVWMESNYPDF 415 Saccharomyces c...
XP_002550404 329 EALIKQFTDKVNPLSCTshkEAKKLAKELTGKDIYFNWDVARAREGYYRYQGGTQCAVMRGRAFAPYADLIWMESALPDY 408 Candida tropica...
P45456       319 RRKLNEWMHHSSYERCLsneEGREIAEKLGVRNLFWDWDLPRTREGFYRFKGSVTASVVRGCAFSPHADVIWMETASPNV 398 soybean
1DQU_A       402 KQAKEFADGVHAVWPEQKLAYNLSPSFNWKKAMPRDE-QETYIKRLGALGYAWQFITLAGLHTTALISDTFAKAYAKQGM 480 Aspergillus nid...
P28298       402 KQAKEFADGVHAVWPEQKLAYNLSPSFNWKKAMPRDE-QETYIKRLGALGYAWQFITLAGLHTTALISDTFAKAYAKQGM 480 Aspergillus nid...
P28299       413 AQAEEFAKGVHAVWPEQKLAYNLSPSFNWKTAMGRDD-QETYIRRLAKLGYCWQFITLAGLHTTALISDQFAKAYSKIGM 491 Neurospora cras...
P41555       402 AQAKEFAEGVKNAVPHQWLAYNLSPSFNWTTAMSPED-QETYISRLAKLGYVWQFITLAGLHTNALISDKFAKAYSERGM 480 Yarrowia lipoly...
P28240       416 QQAKEFAEGVKEKFPDQWLAYNLSPSFNWPKAMSVDE-QHTFIQRLGDLGYIWQFITLAGLHTNALAVHNFSRDFAKDGM 494 Saccharomyces c...
XP_002550404 409 NQAKEFADGVKAAVPDQWLAYNLSPSFNWNKAMPADE-QETYIKRLGKLGYVWQFITLAGLHTTALAVDDFANQYSQIGM 487 Candida tropica...
P45456       399 VECTEFSEGVRSKHPQMMLGYNLSPSFNWDASGMSDEqMKDFIPKIAKLGYVWQFITVGGLHSNALITSTFARDFANRGM 478 soybean
1DQU_A       481 RAYGELVQEPEMANGVDVVTHQKWSGANYVDNMLKMITGGVSSTAAMGKGVTEDQF 536 Aspergillus nidulans FGSC A4
P28298       481 RAYGELVQEPEMANGVDVVTHQKWSGANYVDNMLKMITGGVSSTAAMGKGVTEDQF 536 Aspergillus nidulans FGSC A4
P28299       492 RAYGELVQEPEIDNGVDVVKHQKWSGATYVDELQKMVTGGVSSTAAMGKGVTEDQF 547 Neurospora crassa OR74A
P41555       481 KAYGGEIQQPEIDQGCEVVKHQKWSGAEYIDGILRMVTGGITSTAAMGAGVTEDQF 536 Yarrowia lipolytica CLIB122
P28240       495 KAYAQNVQQREMDDGVDVLKHQKWSGAEYIDGLLKLAQGGVSATAAMGTGVTEDQF 550 Saccharomyces cerevisiae S288C
XP_002550404 488 RAYGQTVQQPEIEKGVEVVKHQKWSGANYIDGLLRMVSGGVTSTAAMGKGVTEDQF 543 Candida tropicalis MYA-3404
P45456       479 LAYVERIQREERNNGVDTLAHQKWAGANYYDRYLKTVQGGVASTAAMGKGVTEEQF 534 soybean
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap