3J3V,1NKW,1VS6,2J01,2GHJ,4V19


Conserved Protein Domain Family
Ribosomal_L20

?
pfam00453: Ribosomal_L20 
Click on image for an interactive view with Cn3D
Ribosomal protein L20
Statistics
?
PSSM-Id: 334086
View PSSM: pfam00453
Aligned: 439 rows
Threshold Bit Score: 88.5919
Threshold Setting Gi: 312068741
Created: 15-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3J3V_Q         6 GGTVTRKRRKKVLKLAKGYFGSKH----TLYKVANQQVMKSGNYAFRDRRQKKRDFRKLWITRINAAARMNGLSYSRLMH 81  Bacillus subtil...
XP_003137356  24 ikpDVWQKREQLRRFVAWQYGFQR----TTVRRGLRKLNKLYTYLSMQREDAPRLEKYYAEERVRAALAEYHFDYAPFRN 99  eye worm
XP_019961328  13 RGPDRYWKVQEVLKHARHFRGRKN----RCYSLAVRAVRRAFVYATKARRLKKRNMRTLWISRIAAASREHGMKYPALMH 88  Japanese flounder
XP_007256752  13 RGPDRYWKVQELLKNARHFRGRKN----RCYKLAVRTVCRAFVYATKARKVKRRSMRTLWISRIAAASREHGLKYPALIH 88  Mexican tetra
NP_001264971  13 rltdRFWRVQEVLKYARHFRGRKN----RCYKLAVRNVQRAFVKSTRARKQKKRFLRALWITRIEAASLEHGLKYSAFIS 88  chicken
XP_003228740  13 rltDRYWRKLEVLQHARHFRGRKN----RCYALAVRAVRRAFVYATNARSLKKRDMRKLWEERIEAASLEHGVKYHVFMS 88  green anole
XP_007481145  13 rlTDRFWRTQDLLQYARHFRGRKN----RCHRLAVRTETSAFVKCSKARRLKKKNMRTLWINRITAASQEHGLKYPSFIS 88  gray short-tail...
XP_011724836 418 rvTYSYWRVQEVLKHAKHFRRRSGxggnCCYRLAVRAGTRAFVKCTKARNLKKRITRTLWINRITAATQSHGPTYPAFTG 497 pig-tailed macaque
XP_003461560  13 rvtdrYFRIQEVLKHARHFRGRKN----RCYRLAVRAVTRAFVKCTRARKLKKRNLRTLWINRITAASQEHGLKYSVFIN 88  domestic guinea...
XP_005986117  13 RGPDRYWKVQEVLKHARHFRGRKN----RCYRLAVRTVRRAFVHSTKARQAKKRNMRTLWISRIAAASREHGLKYPILIS 88  coelacanth
3J3V_Q        82 GLKLSGIEVNRKMLADLAVNDLTAF 106 Bacillus subtilis subsp. subtilis str. 168
XP_003137356 100 MLAKAHILLDNIVISQLAIYEPESF 124 eye worm
XP_019961328  89 NLTKTSVQLNRHVISDLAITEPRSF 113 Japanese flounder
XP_007256752  89 NLVKSSVQLNRRILSDLAITEPRTF 113 Mexican tetra
NP_001264971  89 NLFKTQVELNRKMIADLAIYEPKTF 113 chicken
XP_003228740  89 NLYKCQVELNRKALADLAIYEPKTF 113 green anole
XP_007481145  89 NLVKCQVELNRKVLADLAIYEPKTF 113 gray short-tailed opossum
XP_011724836 498 NLIKCQVERHRKIIADLAIYEPKTF 522 pig-tailed macaque
XP_003461560  89 NLIKCQVELNRKVLADLAIYEPKTF 113 domestic guinea pig
XP_005986117  89 NLIKCQVALNRKVLSDLAIYEPKTF 113 coelacanth
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap