Conserved Protein Domain Family
Ribosomal_L20

?
pfam00453: Ribosomal_L20 
Ribosomal protein L20
Statistics
?
Aligned: 431 rows
Threshold Bit Score: 88.9794
Threshold Setting Gi: 307767485
Created: 14-Jun-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P19948          3 RIKRGYIARKRRTKIRLFTSSFRGAHSRLTRTITQQKIKALVSAHRDRDRKKRDFRGLWISRINAVIRGNiKVyyIYSNL 82  soybean
XP_005986117   10 irnRGPDRYWKVQEVLKHARHFRGRKNRCYRLAVRTVRRAFVHSTKARQAKKRNMRTLWISRIAAASREH-GL--KYPIL 86  coelacanth
65_pfamImport   1 ---RGPDRYWKVQELLKNARHFRGRKNRCYKLAVRTVCRAFVYATKARKVKRRSMRTLWISRIAAASREH-GL--KYPAL 74 
5_pfamImport    1 ---RGPDGYWKHQEILKHARHFRGRKNRCYSLAVRAVRRAFVYATSARRLKKRNMRTLWITRIAAASREH-GM--KYPAL 74 
XP_003461560   10 lrnrvtdrYFRIQEVLKHARHFRGRKNRCYRLAVRAVTRAFVKCTRARKLKKRNLRTLWINRITAASQEH-GL--KYSVF 86  Domestic guine...
XP_007481145   10 vrarlTDRFWRTQDLLQYARHFRGRKNRCHRLAVRTETSAFVKCSKARRLKKKNMRTLWINRITAASQEH-GL--KYPSF 86  gray short-tai...
NP_001264971   10 lrsrltdRFWRVQEVLKYARHFRGRKNRCYKLAVRNVQRAFVKSTRARKQKKRFLRALWITRIEAASLEH-GL--KYSAF 86  chicken
BAH71791       10 vrsRGPDEFWRKRKIFKIAAHFSGRRRNCYSIAIKAVHRALQFATIGRTVRKTDMIDLWNTRIKAGCEEH-GV--EINNF 86  pea aphid
EEC16122       11 RVKSGGNRFWKRKRIFQLAANFYGRRRNCFTIAIRSVEKALTHVAEGRQVKKTEMGRLWKTRTEAAAQEL-GF--NYANL 87  black-legged tick
EFO26719       21 hvkikpDVWQKREQLRRFVAWQYGFQRTTVRRGLRKLNKLYTYLSMQREDAPRLEKYYAEERVRAALAEY-HF--DYAPF 97  eye worm
P19948         83 VYSLYTGQLLLNRKIVAQIAILKQNCL 109 soybean
XP_005986117   87 ISNLIKCQVALNRKVLSDLAIYEPKTF 113 coelacanth
65_pfamImport  75 IHNLVKSSVQLNRRILSDLAITEPRTF 101
5_pfamImport   75 VHNLTKTSVQLNRRVISDLAVTEPRSF 101
XP_003461560   87 INNLIKCQVELNRKVLADLAIYEPKTF 113 Domestic guinea pig
XP_007481145   87 ISNLVKCQVELNRKVLADLAIYEPKTF 113 gray short-tailed opossum
NP_001264971   87 ISNLFKTQVELNRKMIADLAIYEPKTF 113 chicken
BAH71791       87 KDSLSRCDIQLNKKVLADLAIWEPNSF 113 pea aphid
EEC16122       88 RHNLTKCSIALDRRILSDLAYSEPRTF 114 black-legged tick
EFO26719       98 RNMLAKAHILLDNIVISQLAIYEPESF 124 eye worm
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap