5GAD,4UE5,3DMD,5L3R,4C7O,2V3C,5L3S,1ZU4,2PX0


Conserved Protein Domain Family
SRP54

?
pfam00448: SRP54 
Click on image for an interactive view with Cn3D
SRP54-type protein, GTPase domain
This family includes relatives of the G-domain of the SRP54 family of proteins.
Statistics
?
PSSM-Id: 334082
View PSSM: pfam00448
Aligned: 58 rows
Threshold Bit Score: 199.688
Threshold Setting Gi: 544314
Created: 15-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5GAD_LL 294 FVILMVGVNGVGKTTTIGKLARQFEQQ---GKSVMLAAGDTFRAAAVEQLQVWGQRNNIPviaqhtgaDSASVIFDAIQA 370 Escherichia coli K-12
Q01960  176 KYIVLFGSTGAGKTTTLAKLAAISMLEk--HKKIAFITTDTYRIAAVEQLKTYAELLQAP--------LEVCYTKEEFQQ 245 Bacillus subtilis su...
O25679  257 RILMLVGPTGVGKTTTLAKLAARYSRMlakKYKVGIITLDNYRIGALEQLSWYANKMKmsi------eaVIDAKDFAKEI 330 Helicobacter pylori ...
O67266  173 KVVALVGPTGVGKTTTLAKLAHLFKKN---KKKVGIISLDCFRVGAFEQLKAFAEVLEVPfkl---adSPRAFNIQLLEM 246 Aquifex aeolicus VF5
O27645  164 LVIMFVGINGTGKTTTIAKVARYFMKK---GLEPVIAAADTFRAGAIEQIGQHADKLGVKlishrkgaDPAAVAFDAVSH 240 Methanothermobacter ...
O28217  146 VVIAFVGVNGTGKTTTIAKVANRLIKQ---GYSVVLAAGDTFRAGAIEQLEEHAKRLGVKlikhkhgsDPAAVIYDAIKH 222 Archaeoglobus fulgidus
Q57739  203 TVIVFVGINGTGKTTTIAKLAYKLKQK---GYSVVLAAGDTFRAGAIEQLEQHAKNVGVKvikhkpgaDSAAVIYDAIQH 279 Methanocaldococcus j...
Q5JF74  146 FVIAFVGFNGSGKTTTIAKLAHWLKKN---GFSVVIAASDTFRAGAIEQLEEHAKRVGVKvikhdygaDPAAVAYDAIQH 222 Thermococcus kodakar...
3DMD_B  130 yVIMFVGFNGSGKTTTIAKLANWLKNH---GFSVVIAASDTFRAGAIEQLEEHAKRIGVKvikhsygaDPAAVAYDAIQH 206 Pyrococcus furiosus
5L3S_B  102 FVIIFFGVNGVGKTTTIAKVVNMLKKN---NLSTIIAASDTFRAAAQEQLAYHASKLEVQlirgkygaDPASVAFDAISF 178 Sulfolobus acidocald...
5GAD_LL 371 AKARN--IDVLIADTAGRLQNKSHLMEELKKIVRVMKkldveaPHEVMLTIDASTGQNAVS-QAKLFHEAVgLTGITLTK 447 Escherichia coli K-12
Q01960  246 AKELFseYDHVFVDTAGRNFKDPQYIDELKETIPFES------SIQSFLVLSATAKYEDMKhIVKRFSSVP-VNQYIFTK 318 Bacillus subtilis su...
O25679  331 EALEY--CDFILVDTTGHSQYDKEKIAGLKEFIDGGY------NIDVSLVLSVTTKYEDMK-DIYDSFGVLgIDTLIFTK 401 Helicobacter pylori ...
O67266  247 DDR-----DVILVDTAGRSHYDVIRLKELETYFKVS-------DISVYLTLAANLSELVMYeAIMQFGMFS-ISGLIFTK 313 Aquifex aeolicus VF5
O27645  241 AKAQG--KDVVLIDTAGRMQTNVNLMDEMAKIKRVVR------PDLIVFVGDALTGNDAIE-QAARFDEAVgIDAVILTK 311 Methanothermobacter ...
O28217  223 AESKG--IDVVLADTAGRMHTKKNLLDQLEKIKRVTK------PDLIIFVDESIAGNDAVE-RARMFAETVgIDGSILTK 293 Archaeoglobus fulgidus
Q57739  280 AKARG--IDVVLADTAGRQATNVNLMEEIKKVVRVTK------PDLVIFVGDALTGNDAVY-QAEEFNRAVnIDGIILTK 350 Methanocaldococcus j...
Q5JF74  223 AKARG--IDVVLIDTAGRNELNRNLMDEMKKIARVTK------PDLVIFVGDSLGGNAVVE-QAKQFNEAVrIDGVILTK 293 Thermococcus kodakar...
3DMD_B  207 AKARG--IDVVLIDTAGRSETNRNLMDEMKKIARVTK------PNLVIFVGDALAGNAIVE-QARQFNEAVkIDGIILTK 277 Pyrococcus furiosus
5L3S_B  179 AKSRN--IDVVLIDTAGRMHIDSDLVEELKKVLRIAK------PDFRILILDSLAGSDALE-QARHFENNVgYDAVILTK 249 Sulfolobus acidocald...
5GAD_LL 448 LDGTAKGGVIFSVADQFGIPIRYIGVGERI-EDLRPFKADDFIEAL 492 Escherichia coli K-12
Q01960  319 IDETTSLGSVFNILAESKIGVGFMTNGQNVpEDIQTVSPLGFVRML 364 Bacillus subtilis subsp. subtilis str. 168
O25679  402 LDESRGLGNLFSLVHESQKPISYLSVGQEVpMDLKVATNEYLVDCM 447 Helicobacter pylori 26695
O67266  314 LDETPYPGSMVNVAYRTQYPVVCFTMGQSIpEDIVVANYDYLVRLI 359 Aquifex aeolicus VF5
O27645  312 ADADARGGAALSIGYMIKRPIIFMGIGQGY-DDIMEFKPEWMVEQL 356 Methanothermobacter thermautotrophicus str. Delta H
O28217  294 LDADPKGGSAISISYVTKKPVLFFGVGQEY-DDLVKFDSKWLVERI 338 Archaeoglobus fulgidus
Q57739  351 VDADAKGGAALSIGYAIGKPILYLGVGQRY-QDLIEFDADWMVRKL 395 Methanocaldococcus jannaschii DSM 2661
Q5JF74  294 LDADARGGAALSISHAIGAPILFVGVGQGY-EDLRPFDEKWFVERI 338 Thermococcus kodakarensis KOD1
3DMD_B  278 LDADARGGAALSISYVIDAPILFVGVGQGY-DDLRPFEKEWFLERI 322 Pyrococcus furiosus
5L3S_B  250 VDADAKGGIALSLAYELKKPVVYMGVGQNY-DDLIPFSPDWFVERI 294 Sulfolobus acidocaldarius DSM 639
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap