5M6S,1U5P,1U4Q,1SJJ,1SJJ,1SJJ,5J4O,5J4O,3F31,3F57,3F57,3FB2,4D1E,3LBX,3KBU,3EDV,3EDV,1S35,3UUN,3LBX


Conserved Protein Domain Family
Spectrin

?
pfam00435: Spectrin 
Click on image for an interactive view with Cn3D
Spectrin repeat
Spectrin repeat-domains are found in several proteins involved in cytoskeletal structure. These include spectrin, alpha-actinin and dystrophin. The sequence repeat used in this family is taken from the structural repeat in reference. The spectrin domain- repeat forms a three helix bundle. The second helix is interrupted by proline in some sequences. The repeats are defined by a characteristic tryptophan (W) residue at position 17 in helix A and a leucine (L) at 2 residues from the carboxyl end of helix C. Although the domain occurs in multiple repeats along sequences, the domains are actually stable on their own - ie they act, biophysically, like domains rather than repeats that along function when aggregated.
Statistics
?
Aligned: 100 rows
Threshold Bit Score: 41.1396
Threshold Setting Gi: 313104240
Created: 14-Mar-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5M6S_A   33 HRLHQFFRDMDDEESWIKEK-KLLV---SSEDY-GRDLTGVQNLRK---KHKRLEAELAAHEPAIQGVL----DTGKKL- 99   Escherichia coli
P11532 1877 HQWYQYKRQADDLLKCLDDI-EKKL---ASLPE-PRDERKIKEIDR---ELQKKKEELNAVRRQAEGLS----EDGAAM- 1943 human
P02549 2043 DLFVEFAHKASALNNWCEKM-EENL---SEPVH-CVSLNEIRQLQK---DHEDFLASLARAQADFKCLL----ELDQQI- 2109 human
Q13813 2091 DLFLTFAKKASAFNSWFENA-EEDL---TDPVR-CNSLEEIKALRE---AHDAFRSSLSSAQADFNQLA----ELDRQIk 2158 human
Q08043  644 RLRRQFAAQANAIGPWIQAK-VEEV-----GRLaAGLAGSLEEQMA---GLRQQEQNIINYKTNIDRLE----GDHQLL- 709  human
P35609  637 RLRRQFAAQANAIGPWIQNKmEEIA---------RSSIQITGALEDqmnQLKQYEHNIINYKNNIDKLEgdhqLIQEALv 707  human
P02549 2157 EMCQEFEQNASTFLQWILET-RAYF---LDGSL-LKETGTLESQLE---ANKRKQKEIQAMKRQLTKIV----DLGDNL- 2223 human
Q13813 2205 KLRQEFAQHANAFHQWIQET-RTYL------LDgSCMVEESGTLESqleATKRKHQEIRAMRSQLKKIEdlgaAMEEALi 2277 human
P11532  830 NNIIAFYNQLQQLEQMTTTA-ENWL---KIQPTtPSEPTAIKSQLK---ICKDEVNRLSDLQPQIERLK----IQSIAL- 897  human
1SJJ_A  606 rlrkQFGAQANVIGPWIQTK-MEEIgriSIEMH-G----TLEDQLN---HLRQYEKSIVNYKPKIDQLE----GDHQQI- 671  chicken
5M6S_A  100 SDDNTIGKEEIQQRLAQFVDHWKELKQLAAARGQRLE 136  Escherichia coli
P11532 1944 AVE--PTQIQLSKRWREIESKFAQFRRLNFAQIHTVR 1978 human
P02549 2110 KALGVPSSPYTWLTVEVLERTWKHLSDIIEEREQELQ 2146 human
Q13813 2159 SFRV-ASNPYTWFTMEALEETWRNLQKIIKERELELQ 2194 human
Q08043  710 QESLVFDNKHTVYSMEHIRVGWEQLLTSIARTINEVE 746  human
P35609  708 FDN-----KHTNYTMEHIRVGWELLLTTIARTINEVE 739  human
P02549 2224 EDA---LILDIKYSTIGLAQQWDQLYQLGLRMQHNLE 2257 human
Q13813 2278 LDN-----KYTEHSTVGLAQQWDQLDQLGMRMQHNLE 2309 human
P11532  898 -KEKGQGPMFLDADFVAFTNHFKQVFSDVQAREKELq 933  human
1SJJ_A  672 QEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVE 708  chicken
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap