Conserved Protein Domain Family
ATP-synt_B

?
pfam00430: ATP-synt_B 
ATP synthase B/B' CF(0)
Part of the CF(0) (base unit) of the ATP synthase. The base unit is thought to translocate protons through membrane (inner membrane in mitochondria, thylakoid membrane in plants, cytoplasmic membrane in bacteria). The B subunits are thought to interact with the stalk of the CF(1) subunits. This domain should not be confused with the ab CF(1) proteins (in the head of the ATP synthase) which are found in pfam00006
Statistics
?
PSSM-Id: 278838
View PSSM: pfam00430
Aligned: 14 rows
Threshold Bit Score: 87.7423
Threshold Setting Gi: 114694
Created: 11-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226694421   9 TLIVQLVTFVILVALLYKYMYGPLRKVMDDRRAKIADGLAAAERGKEEMALAQKRATELLREAKDKAAEIIANAERRGVE 88
gi 123561164   6 TILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASATDQLKKAKAEAQVIIEQANKRRSQ 85
gi 81346273   20 TIIYQLLMFIILLALLRKFAWQPLMNIMKQREEHIANEIDQAEKRRQEAEKLLEEQRELMKQSRQEAQALIENARKLAEE 99
gi 114619     17 NIIVVSGSFLILMFLLKHFAWGPISDILKKREDKIANDLDSAEKSRINSAKMEQEREQQLLASRSDAADIIKNAKESGEL 96
gi 123525686  12 qIVWLVIALVAMYFVMSRLAIPRLAEVLEQRQRLINDDLKQAEALKAETEAAIAAYETALAEARARAHDEIRAVTEAAAK 91
gi 1352041    26 ILATNLINLTVVVGVLIFFGKGVLKDLLDNRKQRILSTIRNSEELRKGTLEQLEKARIRLQKVELEADEYRMNGYSEIER 105
gi 114614     33 ILDTNLINLAIIITVLFVFGRKVLGNTLKTRRENIETAIKNAEQRAADAAKQLKEAQQKLEQAQAEAERIKKSAQDNAQT 112
gi 2506210    26 FLEANLFNLAILLGIIIYYAPKTLGKILGDRRQKIADAIEEAETRQRKSAQILAEEEKKLAQAKAEAARIVQEAGQRAEV 105
gi 123557490  21 lFETNLINLAIIIGLLVYAGRGFLGNLLSNRRAAIEAEIREVEEKLASSAQALSQAQTQLKEAEAEAARLLVEAKARAAA 100
gi 33860134   47 VFVAHTIALSIIILLGIFLLWKPTKRFLAKRSELIQAEINNANEIKKQAQFLLDNAKKQKQNAELQAREIINLATNQAYR 126
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|.
gi 226694421  89 LREEAQGKAREEADRIIASARAEIDVETNRAREVLRGQVVELVVNGTQRIL 139
gi 123561164  86 ILDEAKAEAEQERTKIVAQAQAEIEAERKRAREELRKQVAILAVAGAEKII 136
gi 81346273  100 QKEQIVASARAEAERVKEVAKKEIEREKEQAMAALREQVASLSVLIASKVI 150
gi 114619     97 SRQNILKETQEEVARLKSKAQTDIMLERDTALNSVKDDVADLSLQIAAKIL 147
gi 123525686  92 AAEARNAEVAKALNTRIKDGEARIVQARDEALTHVREVAGAVASDIVGKLA 142
gi 1352041   106 EKENLINATSISLEQLEKSKNETLYFEKQRAMNQVRQQGFQQAVQGALGTL 156
gi 114614    113 AGQAIIAQAAVDIERLQEAGAADLNAELDRAIAQLRQRVVALALQKVESEL 163
gi 2506210   106 AKQEIATQTEADLRRMQEAAAQDLGAEQERVIAELKRRIAEQAVAKAEADL 156
gi 123557490 101 VRQEILDKAAADVERLKATAAQDVSTEQQRVLDELRRYAVAQALSRVETQL 151
gi 33860134  127 LKNDLETDAKRKANRIIENAHAEIIKQESILKRELEGRIVDVALEATSTLI 177
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap