2GY9,1FJG,5O5J,5AJ3


Conserved Protein Domain Family
Ribosomal_S17

?
pfam00366: Ribosomal_S17 
Click on image for an interactive view with Cn3D
Ribosomal protein S17
Statistics
?
Aligned: 655 rows
Threshold Bit Score: 36.9741
Threshold Setting Gi: 528326780
Created: 3-Jun-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2GY9_Q     5 GRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNE--CGIGDVVEIRECRPLSKTKSWTLVR 72  Escherichia coli
EDO76865  71 GVVHSAKMQRSIIVRRDYLHFVQKYKRYERRHKHVAAHLSPCFr-VKEGDIVTIGECRPLSKTIRFNVIK 139 Giardia lamblia ATCC 50803
ETN99496 121 GRVKTAKMTRAIIVRREYLHYVRKYNRYEKRHTNVPAHLPPCFr-VKAGDTVTLGQCRPLSKTIRFCVIR 189 Reticulomyxa filosa
EZG89317  81 GMIVSAKMKRTVVIRRHYLHYIPKYNRFEKRHTNLNAHISPCFe-YKEGDIVTIGECRPISKTVSFNVLN 149 Gregarina niphandrodes
EGB03069  80 GMVISTKMKRTLVIRRDYLNWCGKYRRFEKRHKNMSVHCSPCFenVKEGDIVTVGQCRPLTKTVRFNVLt 149 Aureococcus anophagefferens
EAX87627  71 GVVVSTKMRRTIIIRRDYLQWIRKYKRFEKRHTKIPAHISPAFl-VKEGDLVTVAECRPLSKTVHFNVIH 139 Trichomonas vaginalis G3
EGG07921  78 GRVVSTKMTRTIIIRREYLHFVPKYSRYEKRHQNMAVHCSPAFr-VEIGDQVTVGQCRPLSKTVRFNVLR 146 Melampsora larici-populina 98...
KEI42091  73 GEVIKTKMTRTIVVRMNYLHFIPKYSRYEKRHTNIPVHCSPAFr-VEIGDTVTVGETRPISKTVRFTVLR 141 Mixia osmundae IAM 14324
CAM67535  56 GVVHSTKMHRTIIIRRNYLHFIKKYQRYQKRHKSLAVHCSPAFd-PKQGDEVVIGQCRPLSKTIRYNVLE 124 Leishmania infantum JPCM5
EFC39569  85 GVVKSHKMARTLIVRRDYLKYEKKYNRYEKRHKNVAAHISPAFe-AHEGDVVVIGECRPLSKTVRFNVVK 153 Naegleria gruberi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap