3UR7


Conserved Protein Domain Family
Glyco_hydro_17

?
pfam00332: Glyco_hydro_17 
Click on image for an interactive view with Cn3D
Glycosyl hydrolases family 17
Statistics
?
PSSM-Id: 366033
Aligned: 7 rows
Threshold Bit Score: 369.135
Created: 16-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3UR7_A     3 IGVCYGKIANNLPSDQDVIKLYNANNIKKMRIYYPHTNVFNALKGSNIEIILDVPNQDLEALANP-SNANGWVQDNIRNH 81  potato
Q01413    27 IGVCYGMMGNNLPSHSEVIQLYKSRNIRRLRLYDPNHGALNALRGSNIEVILGLPNVDVKHISSGmEHARWWVQKNVRDF 106 tomato
Q01412    26 IGVCYGKIANNLPSDQDVIKLYNSNNIKKMRIYFPETNVFNALKGSNIEIILDVPNQDLEALANP-SKRQGWVQDNIRNH 104 tomato
BAJ85685  24 IGVNYGMMGSDLPSPDKVVALYKANNVTDVRIFHPDTYVLEALRNSGLGVVLGTLNSDLAPLASDaSYAASWVHSYVQPF 103 domesticated barley
Q5AMT2    22 LAFNLGVK-NDD-GTCKDVSTFEG----DLDFLKSHSKIIKTYAVSDCNTLQNLG--PAAEAEGFqIQLGIWPNDDAHFE 93  Candida albicans SC...
P15703    27 LAFNLGVK-NND-GTCKSTSDYET----ELQALKSYTSTVKVYAASDCNTLQNLG--PAAEAEGFtIFVGVWPTDDSHYA 98  Saccharomyces cerev...
Q06915    42 IGINYGRRGNNLPSPYQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNHQITALSSNqTIADEWVRTNILPY 121 thale cress
3UR7_A    82 FPDVKFKYIAVGNEVDPGRESGkyarFVGPAMENIYNALSSAGLQNqIKVSTSTYSGLLTNTYPPRDSIFREEYK-SFIN 160 potato
Q01413   107 WPHVKIKYIAVGNEISPVTGTSnlapFQVPALVNIYKAIGEAGLGNdIKVSTSVDMTLIGNSYPPSQGSFRNDVR-WFTD 185 tomato
Q01412   105 FPDVKFKYIAVGNEVDPGRDSGkyarFVGPAMENIYNALSSAGLQNqIKVSTATYLGLLTNTYPPRDSIFRDEYK-SFIN 183 tomato
BAJ85685 104 AGAVSFRYINAGNEVIPGESAA----LVLPAVKNLEAALQAAGLS--VPVTTAMATSVLGTSYPPSQGTFSEAAL-PTVG 176 domesticated barley
Q5AMT2    94 AEK--EALQNYLPKISVSTIKI----FLVGSEALYREDLTASELASkINEIKDLVKGIKDKN-GKSYSSVPVGT----VD 162 Candida albicans SC...
P15703    99 AEK--AALQTYLPKIKESTVAG----FLVGSEALYRNDLTASQLSDkINDVRSVVADISDSD-GKSYSGKQVGT----VD 167 Saccharomyces cerev...
Q06915   122 YPQTQIRFVLVGNEILSYNSGNvs-vNLVPAMRKIVNSLRLHGIHN-IKVGTPLAMDSLRSSFPPSNGTFREEITgPVML 199 thale cress
3UR7_A   161 PIIGFLARHNLPLLANIYPYFGHIDN--TnaVPLSYALFNQQ-RRN----DTGYQNLFDALVDSMYFATEKLGGQ-NIEI 232 potato
Q01413   186 PIVGFLRDTRAPLLVNIYPYFSYSGNpgQ--ISLPYALFTAPnVVVqd-gSRQYRNLFDAMLDSVYAAMDRTGGG-SVGI 261 tomato
Q01412   184 PIIGFLSRHNLPLLANIYPYFGHADD--N--VPLPYALFKQQgLN-----DAGYQNLFDALVDSMYFATEKLGGQ-NIEI 253 tomato
BAJ85685 177 PIVSHLASSGTPLLVNVYPYFAYSADpsS--VRLDYALLSSSaAVAvtdnGVEYANMFDAILDAVYAAVEKAGGGeSLEL 254 domesticated barley
Q5AMT2   163 SWNVLVDGASKPAIDAAD--VVYSNS---------FSYWQKNsQAN------ASYSLFDDVMQALQTLQTAKGST-DIEF 224 Candida albicans SC...
P15703   168 SWNVLVAGYNSAVIEASD--FVMANA-----F----SYWQGQtMQN------ASYSFFDDIMQALQVIQSTKGST-DITF 229 Saccharomyces cerev...
Q06915   200 PLLKFLNGTNSYFFLNVHPYFRWSRNpmN--TSLDFALFQGHsTYTdpqtGLVYRNLLDQMLDSVLFAMTKLGYP-HMRL 276 thale cress
3UR7_A   233 IVSESGWPSEGH---PAATLKNARTYYTNLINHVK----RgaGTPKKPGkTIETYLFAMFDENEKKGEa----SEKHFGL 301 potato
Q01413   262 VVSESGWPSAGA---FGATHENAQTYLRNLIQHAK----E--GSPRKPG-PIETYIFAMFDENNKNPE-----LEKHFGM 326 tomato
Q01412   254 IVSESGWPSEGH---PSATLENAMTYYTNLINHVKg--gA--GTPKKPGrTIETYLFAMFDENRKDGKp----SEQHFGL 322 tomato
BAJ85685 255 VVSETGWPSGGGg--YGASVENAAAYINNLVRHVG----R--GTPRRPGkAVETYIFAMFNENQKPEG-----VEQNFGM 321 domesticated barley
Q5AMT2   225 WVGETGWPTDGS------SYGDSVPSVENAADQWQ----K--GICALRAwGINVAVYEAFDEAWKPDTsgtssVEKHWGV 292 Candida albicans SC...
P15703   230 WVGETGWPTDGT-----N-FESSYPSVDNAKQFWK----E--GICSMRAwGVNVIVFEAFDEDWKPNTsgtsdVEKHWGV 297 Saccharomyces cerev...
Q06915   277 AISETGWPNFGDideTGANILNAATYNRNLIKKMSasppI--GTPSRPGlPIPTFVFSLFNENQKSGSg----TQRHWGI 350 thale cress
3UR7_A   302 FNPDQRPKYQLNF 314 potato
Q01413   327 FSPNKQPKYNLNF 339 tomato
Q01412   323 FKPDQRPKYQLKF 335 tomato
BAJ85685 322 FQPDMSQVYHVDF 334 domesticated barley
Q5AMT2   293 WQSDKTLKYSIDC 305 Candida albicans SC5314
P15703   298 FTSSDNLKYSLDC 310 Saccharomyces cerevisiae S288C
Q06915   351 LHPDGSPIYDVDF 363 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap