2GQ1


Conserved Protein Domain Family
FBPase

?
pfam00316: FBPase 
Click on image for an interactive view with Cn3D
Fructose-1-6-bisphosphatase, N-terminal domain
This family represents the N-terminus of this protein family.
Statistics
?
PSSM-Id: 334001
View PSSM: pfam00316
Aligned: 10 rows
Threshold Bit Score: 244.622
Threshold Setting Gi: 159467635
Created: 14-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2GQ1_A         2 KTLGEFIVEKQHEFSh-ATGE-----LTALLSAIKLGAKIIHRDINKAGLVDILGASGAENVQGEVQQKLDLFANEKLKA 75
gi 462044     19 ITLSRFILDQQHLSAknATGE-----FSMLLNSLQFAFKFISQTIRRAELVNLIGLAGASNSTGDQQKKLDVLGDEIFIN 93
gi 119747     21 ITLPRFIIEHQKQFKn-ATGD-----FTLVLNALQFAFKFVSHTIRRAELVNLVGLAGASNFTGDQQKKLDVLGDEIFIN 94
gi 123561035   2 kTLGEFIVEKQHEFSh-ATGE-----LTALLSAIKLGAKIIHRDINKAGLVDILGASGAENVQGEVQQKLDLFANEKLKA 75
gi 123612780   5 MTLQERMDGEGGSDP--LRQA-----VKGAVAALAQAAIDISDLTCRGALAGITGQAQGRNTDGDVQKDLDVRADQIIRD 77
gi 1173345    69 STVTKCEIGQSLEEF--LAQAtpdkgLRTLLMCMGEALRTIAFKVRTAS----CGGTACVNSFGDEQLAVDMLADKLLFE 142
gi 297846768  13 MTITRFVLNEQSKYPe-SRGD-----FTILLSHIVLGCKFVCSAVNKAGLAKLIGLAGETNIQGEEQKKLDVLSNDVFVK 86
gi 1169583     2 KTLSEFIVERQAEYPn-AKGE-----LSGILSSIRLLAKIIHRDINKAGLTNILGQSGIENVQGESQMKLDLFAHNTMKA 75
gi 159467635  68 aVLTQAKIGDSLAEF--LVEAtpdpkLRQLMMSMAEATRTIAHKVRTAS----CAGTACVNSFGDEQLAVDMVADKLLFE 141
gi 635075013  12 nTLTRFVMEEGRKAR--GTGE-----LTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVMN 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2GQ1_A        76 ALKARDIVAGIASEEEDEIVVFe--GCEHAKYVVLXDPLDGSSNIDVNVSVGTIFSIYRrv--------tPvGTPVTeE- 144
gi 462044     94 AMKASGNVKVLVSEEQEDLIVF---RNSPGKYAVCCDPIDGSSNLDAGVSVGTIVSLFKihenqngnsgeE-DSEGT-In 168
gi 119747     95 AMRASGIIKVLVSEEQEDLIVF---PTNTGSYAVCCDPIDGSSNLDAGVSVGTIASIFRl---------lP-DSSGT-In 160
gi 123561035  76 ALKARDIVAGIASEEEDEIVVFe--GCEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRrv-------tpV-GTPVT-Ee 144
gi 123612780  78 ALGKQ-PIAALASEEMEELDIL----NPGAPICVAFDPLDGSSNINTNMSVGTIFSIMPtp--------sD-VNA----- 138
gi 1173345   143 ALQYSHVCKYACSEEVPELQDMg--GPVEGGFSVAFDPLDGSSIVDTNFTVGTIFGVWP-----------G-DKLTG-I- 206
gi 297846768  87 ALVSSGRTSVLVSEEDEEATFVe--PSKRGKYCVVFDPLDGSSNIDCGVSIGTIFGIYTld--------hT-DEPTT-E- 153
gi 1169583    76 ALMAREEVAGFASEEEESFIAFdteRGRNAKYIILTDPLDGSSNIDVNVSVGTIFSIYRrv-------spI-GSPVT-Le 146
gi 159467635 142 ALKYSHVCKLACSEEVPEPVDMg--G---EGFCVAFDPLDGSSIVDTNFAVGTIFGVWP-----------G-DKLTN-I- 202
gi 635075013  85 MLKSSFATCVLVSEEDKHAIIVe--PEKRGKYVVCFDPLDGSSNIDCLVSIGTIFGIYRkk--------sT-DEPSE-K- 151
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|
2GQ1_A       145 DFLQPGNKQVAAGYVVYGSSTXLVYTTGC--GVHAFTYDPSLGVFCLCQE 192
gi 462044    169 DVARCGREMVAACYTMYGASTHLVLTTGA--GVNGFTLDNNLGEFILTYP 216
gi 119747    161 DVLRCGKEMVAACYAMYGSSTHLVLTLGD--GVDGFTLDTNLGEFILTHP 208
gi 123561035 145 DFLQPGNKQVAAGYVVYGSSTMLVYTTGC--GVHAFTYDPSLGVFCLCQE 192
gi 123612780 139 AFRQAGSEQLAAGFVVYGPQTSLVLTLGQ--GVDIFTLDRVDRVFKLTGS 186
gi 1173345   207 ----TGGDQVAAAMGIYGPRTTYVLAVKGfpGTHEFLL-LDEGKWQHVKE 251
gi 297846768 154 DVLKPGNEMVAAGYCMYGSSCMLVLSTGT--GVHGFTLDPSLGEFILTHP 201
gi 1169583   147 DFMQPGNKQVAAGYIVYGSSTMLVYTTGN--GVNGFTYDPSIGTFCLSHE 194
gi 159467635 203 ----TGREQVAAGMGIYGPRTVFCIALKDapGCHEFLL-MDDGKWMHVKE 247
gi 635075013 152 DALQPGRNLVAAGYALYGSATMLVLAMDC--GVNCFMLDPAIGEFILVDK 199
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap