3LRE,1SDM


Conserved Protein Domain Family
Kinesin

?
pfam00225: Kinesin 
Click on image for an interactive view with Cn3D
Kinesin motor domain
Statistics
?
Aligned: 72 rows
Threshold Bit Score: 307.175
Threshold Setting Gi: 51316544
Created: 19-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3LRE_A     17 RVRPENTKEKAAGFHKVVHVVdkhilvfdpkqeevsffHGKKTTNQNVIKKQNKDLKFVFDAVFDETST--QSEVFEHTT 94  human
Q5E913     26 RVRPFLPREISDESCDGRSCVsvig---------gdggDTSEVAVYLKDPDSCRNESYQLDAFYGREDDn-VKHIFDREV 95  thale cress
Q6P3R1     24 RLRPYMEKEDEKAPAACVRG------------------LDSQSLEIVNWRNQLETMQYQFDAFYGDSAT--QREIYMGSV 83  tropical clawed frog
P32364     33 RAIPEKGLQNNESTFKIDPYEn---------------tVLFRTNNPLHETTKETHSTFQFDKVFDANAT--QEDVQKFLV 95  Saccharomyces cere...
Q9HAQ2     12 RVKPTDDFAHEMIRYGDDKRSid--------------ihLKKDIRRGVVNNQQTDWSFKLDGVLH-DAS--QDLVYETVA 74  human
Q9V877     93 RLRPVKDASKAYIVSEEANVL-----------------ITSCKVDSTSNNVNRMEKHFGFTSIFDSTVG--QRDIYDTC- 152 fruit fly
Q9VZF5     42 RVRPLQSDADLTSLRVKNSTTial------------npQDQLLQHHKPHNGAQREVQYIFKHVFQPDAT--QQDVYAAVA 107 fruit fly
Q9PUU5     31 RVRPLGAEDEECCIEVISNTTi---------------qLHAPDGLKANRNGEFKETQYSFKKVFGIKTTqrELFEDVAK- 94  zebrafish
O95235     70 RVRPLLPSELERQEDQGCVRIenvetl------vlqapKDSFALKSNERGIGQATHRFTFSQIFGPEVGqaSFFNLTVK- 142 human
NP_999659  29 RLRPVQEDDELCIEVINTNTIq----------------LKPPEGSHAFRTGNYKETQHFFKFVFSEEYS--QKAIYDSIA 90  purple sea urchin
3LRE_A     95 KPILRSFLNGYNCTVLAYGATGAGKTHTMLGSa--DE-PGVMYLTMLHLYKCMDEIK---EE------------------ 150 human
Q5E913     96 SPLIPGIFHGFNATVLAYGATGSGKTFTMQGI---DElPGLMPLTMSTILSMCEKTR---S------------------- 150 thale cress
Q6P3R1     84 CHILPHLLIGQNASVFAYGPTGAGKTHTMLGN---PSqPGVIPRAVRDLLQMTRTAAggpENe----------------- 143 tropical clawed frog
P32364     96 HPIINDVLNGYNGTVITYGPSFSGKSYSLIGS---KEsEGILPNICKTLFDTLEKNE---ETk----------------- 152 Saccharomyces cere...
Q9HAQ2     75 KDVVSQALDGYNGTIMCYGQTGAGKTYTMMGAtenYKhRGILPRALQQVFRMIEERP---THa----------------- 134 human
Q9V877    153 --VGPKIMEEECVTIMTYGTSGSGKTYTLLGd---DVrAGIIPRALENIFTIYQDTV---FRspklklingsivflqdda 224 fruit fly
Q9VZF5    108 QPLVENLLKGRNSLLFTYGVTGSGKTYTMTGN---LRhRGIMPRCLDVLFRTISDYQ---AKkfvfkpdklngfeilsee 181 fruit fly
Q9PUU5     95 -PLAQDLIHGKNGLLFTYGVTGSGKTHTMTGsp-gQG--GLLPRSLDMIFNSIGPYQ---AKryvfkpddkngmevqnqv 167 zebrafish
O95235    143 -EMVKDVLKGQNWLIYTYGVTNSGKTHTIQGti-kDG--GILPRSLALIFNSLQGQL---HPtpdlkpllsneviwldsk 215 human
NP_999659  91 LPLVEDLLHGKNSLLFMYGVTGSGKTYTMQGT---PTdGGVLPRCLDVLFNSLGDLQ---ARkyvfkpdrvngmdvqtea 164 purple sea urchin
3LRE_A        --------------------------------------------------------------------------------     human
Q5E913        --------------------------------------------------------------------------------     thale cress
Q6P3R1        --------------------------------------------------------------------------------     tropical clawed frog
P32364        --------------------------------------------------------------------------------     Saccharomyces cere...
Q9HAQ2        --------------------------------------------------------------------------------     human
Q9V877    225 slkelqirkkl----------------------------------------ldlcpdisahhqrlkqvidgdhmfetkas 264 fruit fly
Q9VZF5    182 dallerqhemnqrfa---------------------------------gsgrfafrhkdsdpeiasqasvepipllglde 228 fruit fly
Q9PUU5    168 dalldrqkrdsqts-----------------------------------vpktpntrrvdpefadmispeeackaegvde 212 zebrafish
O95235    216 qirqeemkklsllngglqeeelstslkrsvyiesrigtstsfdsgiaglssisqctsssqldetshrwaqpdtaplpvpa 295 human
NP_999659 165 damlerqkkelmpppvaprtprt-----------------prapvtprtpstprrpkkafpdldnfvrvpdptclstide 227 purple sea urchin
3LRE_A    151 KI-CSTA-VSYLEVYNEQIRDLLV-----------NSGpLAVREDTQKG-VVVHGLTLHQPKSSEEILHLLDNGNKNRTQ 216 human
Q5E913    151 ----RAE-ISYYEVYMDRCWDLLEv----------kDNeIAVWDDKD-GqVHLKGLSSVPVKSMSEFQEAYLCGVQRRKV 214 thale cress
Q6P3R1    144 NWtYTIT-MSYVEIYQEKVMDLLEp----------kNKdLPIREDKDHn-ILIPGVTQKTINSFGDFDEHFIPASQNRTV 211 tropical clawed frog
P32364    153 GDsFSVS-VLAFEIYMEKTYDLLVpl--------pERKpLKLHRSSSKMdLEIKDICPAHVGSYEDLRSYIQAVQNVGNR 223 Saccharomyces cere...
Q9HAQ2    135 ---ITVR-VSYLEIYNESLFDLLStlpy----vgpSVTpMTIVENPQ-G-VFIKGLSVHLTSQEEDAFSLLFEGETNRII 204 human
Q9V877    265 TDvSVLVwVSFVEIYNELVYDLLAippkqdklgevPRKnLKIVG--NKGhVFIKGLTSVFVTSSEEALRLLRLGQQRSTY 342 fruit fly
Q9VZF5    229 DNmYSVF-VTYIEIYNNSVYDLLEdsg-----iqkTLQsKIIREDANRH-MFVHGVTEVEVKTVEDALEVFQMGQKRKRM 301 fruit fly
Q9PUU5    213 DSsYSVF-VSYIEIYNNYIYDLLEetpfd-pikpkPPQsKILREDQN-HnMYVAGCTEVEVKSTEEAFEVFWRGQKKRRI 289 zebrafish
O95235    296 NIrFSIW-ISFFEIYNELLYDLLEpps-----qqrKRQtLRLCEDQN-GnPYVKDLNWIHVQDAEEAWKLLKVGRKNQSF 368 human
NP_999659 228 DNnYAIF-VSYVEIYNNQIFDLLEeqpys--lhskGLTpRNLREDHIHn-MYVAMCTEVEVKTTEDAYKVFLKGQAKRKV 303 purple sea urchin
3LRE_A    217 HPTDMNATSSRSHAVFQIYLRQQDKtaSinq--------nvRIAKMSLIDLAGSErasTSG-AkGTrFVEGTNINRSLLA 287 human
Q5E913    215 AHTGLNDVSSRSHGVLVISVTSQGL--V--------------TGKINLIDLAGNEdnrRTGn-eGIrLQESAKINQSLFA 277 thale cress
Q6P3R1    212 ASTKLNDRSSRSHAVLLIKVQKSQQ--Vspf--------rqLTGKLYLIDLAGSEdnrRTGn-qGIrLKESGAINSSLFT 280 tropical clawed frog
P32364    224 MACGDKTERSRSHLVFQLHVEQRNR--Kddi---------lkNSSLYLVDLHGAEkfdKRTeStLS-QDALKKLNQSIEA 291 Saccharomyces cere...
Q9HAQ2    205 ASHTMNKNSSRSHCIFTIYLEAHSR--Tlse-------ekyITSKINLVDLAGSErlgKSG-SeGQvLKEATYINKSLSF 274 human
Q9V877    343 ASTSVNANSSRSHCVFTVDILKYNR--Sgi----------ttQSSYKFCDLAGSErvnNTGt-sGLrLKEAKNINTSLMV 409 fruit fly
Q9VZF5    302 GHTVLNAESSRSHSVFNIRLVQAPT--DsqgenvvqdrqniTVSQLSLVDLAGSErssRTKnT-GVrLREAGNINNSLMT 378 fruit fly
Q9PUU5    290 ANTQLNRESSRSHSVFIVKLAQAPL--DadgdnvlqdknqvNVSQLCLVDLAGSErtsRTRaEgNR-LREAGNINQSLMT 366 zebrafish
O95235    369 ASTHLNQNSSRSHSIFSIRILHLQgegdi-------vpkisELS---LCDLAGSEr-cKDQkSgER-LKEAGNINTSLHT 436 human
NP_999659 304 AHNQLNTESSRSHSVFNIRLVQAPL--DslgqeviqdkdqiAISQLSLVDLAGSErthRTNnT-GDrLKEAGSINASLMT 380 purple sea urchin
3LRE_A    288 LGNVINALADSk---------RKnqHIPYRNSKLTRLLKDSLGGNCQTIMIAAVSPssvFYDDTYNTLKYANRAKDI 355 human
Q5E913    278 LSNVVYALNNN----------LP--RVPYRETKLTRILQDSLGGTSRALMVACLNPg--EYQESLRTVSLAARSRHI 340 thale cress
Q6P3R1    281 LSKVVDALNQG----------LP--RIPYRDSKLTRLLQDSLGGTAHSVMIANIAPeqkYYFDTLTALNFAAKSKQI 345 tropical clawed frog
P32364    292 LKNTVRSLSMKerdsaysakgSH--SSAYRESQLTEVLKDSLGGNRKTKVILTCFLs--NVPTTLSTLEFGDSIRQI 364 Saccharomyces cerevis...
Q9HAQ2    275 LEQAIIALGDQk---------RD--HIPFRQCKLTHALKDSLGGNCNMVLVTNIYGeaaQLEETLSSLRFASRMKLV 340 human
Q9V877    410 LGRCLDAASTVqkk-----knAD--IIPYRDSKLTMLLQAALLGKEKLAMIVTVTPldkYYEENLNVLNFASIAKNI 479 fruit fly
Q9VZF5    379 LRTCLEYLRENqlaas-nglaPK--KVPYRDSKITHMFKNYFDGEGQVSMIVCINPrieDYDENMQVMKFAEMTQEV 452 fruit fly
Q9PUU5    367 LRTCIEVLRENqmc-----gtNK--MVPYRDSKVTHLFKNYFDgEGKVRMVVCVNPkadDYEETLLVMRFAEMTQEV 436 zebrafish
O95235    437 LGRCIAALRQNqqn----rskQN--LVPFRDSKLTRVFQGFFTgRGRSCMIVNVNPcasTYDETLHVAKFSAIASQL 507 human
NP_999659 381 LRTCIETLRENqte-----gsNK--MVPYRTSKLTHLFKNYFDGEGKVRMVVNVNPsakDFDETTHVMRFAEITQEV 450 purple sea urchin
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap