2J1Q,1CRK,4WO8,6FH1


Conserved Protein Domain Family
ATP-gua_Ptrans

?
pfam00217: ATP-gua_Ptrans 
Click on image for an interactive view with Cn3D
ATP:guanido phosphotransferase, C-terminal catalytic domain
The substrate binding site is located in the cleft between N and C-terminal domains, but most of the catalytic residues are found in the larger C-terminal domain.
Statistics
?
PSSM-Id: 365953
View PSSM: pfam00217
Aligned: 65 rows
Threshold Bit Score: 195.852
Threshold Setting Gi: 122097948
Created: 19-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2J1Q_A       147 EMESRVKGQLeSMs-gELRGKYYPLTG-----MTKETQKQLIDD--HFLFkegdr--flqaAHAC----KFWPtGRGIYH 212 Trypanosoma cruzi
Q291M9       223 MMGKIFTTSFaDAigeTESGNYYTLTEl----LEPDSEVTLMLSslGLMIslldtkdlvqaAESTafngALWPyGRGVFV 298 Drosophila pseu...
Q17MS1       224 LTSKILSMAFaTAigeEELGTYYTMNEil--eNPSEIRTILATS--GLLIpmldhndpyqtAESIalngKYWPyGRGVYV 299 yellow fever mo...
Q1DA50       121 ALEAEVVQVLsGLr-gHLAGKYHPLAS-----LSEAERLELVHH--HVLFqqsdr--fldsAGVN----RDWPrNRGIFH 186 Myxococcus xant...
A0D308       163 KFENQMVTVFeNF---GIPGNYYSLTPghknfISDQKADELRKR--HFLFidmtsdnhlmsNGVA----SDWPfGRGIWI 233 Paramecium tetr...
Q6APG0       166 RLEEKIVAALsVLa-dDLRGEYHSFEL-----LGAEKMAALRAE--KLIFskgdr--fqeaAGFN----ADFPkSRGIFF 231 Desulfotalea ps...
A0DI85       162 NFESKMVQAFeNF---GIKGKYHSLTPghknqITQEQADELIKR--HFLFndmttdnhltsSGVA----SDWPfGRGIWI 232 Paramecium tetr...
XP_001641899 171 EIIDLMAKVYdSLg-dDLAGNLYRHTT-----MTDEERQKLVDD--HFLFrgkdk--mqaaSGYH----EFWPeGRGIFI 236 starlet sea ane...
XP_022601538 153 AIERLSVEALtSLd-gEFKGKYYPLKS-----MTDAEQEQLIND--HFLFdkpvs-plltcAGMA----RDWPdGRGIMH 219 greater amberjack
XP_001632702 143 GIEQIAKNALgTMq-gEFEGRYYALSS-----MTPQDYHHLSLE--HVLSdatkh-plivsSGMS----RDWPdGRGVWH 209 starlet sea ane...
2J1Q_A       213 NDAKTFLVWVNEEDHLRIISMQKG---GNLKEVFGRLVTAVGVIEEK-V--------KFSRDDRLGFLTFCPTNLGTTIR 280 Trypanosoma cruzi
Q291M9       299 NSAHNMAVWLNCQEHLRVISTTSSkdpGDMGAAYTRVGRAVTYLETQ-L--------HFKESYLLGYLQSRPAFLGTGLK 369 Drosophila pseu...
Q17MS1       300 SHMQDLVAWINAQEHLRVLCCTSSknpANMGSAYSKIGRAMTFLDDK-I--------HFKHSYFLGYLVSRPSFLGTGLK 370 yellow fever mo...
Q1DA50       187 SADMRFIVWVGEEDALRIISMQPG---SGLAQTYLRLQTALEQFDGQ-L--------DFAQDSRLGFLTACPTNLGTAMR 254 Myxococcus xant...
A0D308       234 SQDER------EEDQLRIISIVQG---NDLGKVDQSLHELLNGIEKSgL--------KFAEHPVYGIITTCPTNMGTGKR 296 Paramecium tetr...
Q6APG0       232 SADKGLRIWLGEEDHMRIISQEGS---ADLAAVFNRLGRALTTLEAS-L--------DFVRDESYGYLSSCPTNIGTTMR 299 Desulfotalea ps...
A0DI85       233 SEDETKMIWVGEEDQLRIISIVQG---NDLGKVDQSLHQLLTGIEKSgL--------EFAEHPVYGVITTCPTNMGTGKR 301 Paramecium tetr...
XP_001641899 237 NKAKTFLNWINEGDHLRIISMEMG---GDVKGVFTRLSRGAKAIEDG-VkeatgakdAFMMHPTFGSVTCCPTNIGTGMR 312 starlet sea ane...
XP_022601538 220 NDNKTFLVWVNEEDHLRVISMQKG---GNMREVFKRFCTGLQKIEAI-Fkkh---nhGFMWNEHLGYILTCPSNLGTGLR 292 greater amberjack
XP_001632702 210 TKDKSFLIWVNEEDHLRVISMETG---GDLERTYERFYRGLKELESR-Iqkf---ghEFMRNRHLGYINTCPSNLGTGLR 282 starlet sea ane...
2J1Q_A       281 ASVHIKLPKLGADR--K-KLEEVAAKYNLQVRGTAGEHSDSPD-GVYDISNKRRLGLSEYEAVKEMQDGILELIKAEESA 356 Trypanosoma cruzi
Q291M9       370 MTTIVKLPNLMKEM--D-NLRHLC-----AVRGLSMVTNRLSK-LTVRLINMQSMGIVEYVLFQDYCTAVTNILSLEKDM 440 Drosophila pseu...
Q17MS1       371 MTLFLELPHLRKER--E-NLRHLC-----VVRGLHLLTSDDQ--SRVRMSNMRSLSQTEWQIFQDYTGAITNIVALEKEL 440 yellow fever mo...
Q1DA50       255 ASVLIRLPHLSRR---P-DFRARCARLGLAVRGLHGEHSEARD-GIHDVSNATRLGVTERDIYEQLRTGIHALMEMESAA 329 Myxococcus xant...
A0D308       297 QSILGKFPNLSKAGtdEaNLKDKAKSIGLQARGIGGEHSSVDQeGTADISPSARFGVTEAIVTKRLFEGLIVLYQIEKTT 376 Paramecium tetr...
Q6APG0       300 AGVHIYLEKLNCNR--Q-LLDALTEKHDLQIRGTGGEKTEVDG-AVFDISNRRRLGISERQIITGLHAGLQEIIEAEKSL 375 Desulfotalea ps...
A0DI85       302 QSILGKFPNITNGGkdEkKLKDIARQFGLQARGMGGEHSAMDHeGTADISPSARFGVTEAVVTKRLYEGLIKLYEIEAQL 381 Paramecium tetr...
XP_001641899 313 GSVHILVPKLIAKIgfD-AIDKICRERNCQARGSTGEHSEVI--DRIDVSNWRRIGFPEYQLVDDMIQCVNFLAEEEDKL 389 starlet sea ane...
XP_022601538 293 GGVHVKLPKLSTH---A-KFDEILTRLRLQKRGTGGVDTASVG-GVFDISNADRLGSSEVEQVQLVVDGVKLMVEMEKKL 367 greater amberjack
XP_001632702 283 ASVHVKLPCLGKD---P-RFDAILCSLRLQKRGTDGDNTPIRE-DIYDISNADRLGYTEVQLVQKVIDGVNLLIKMEKRL 357 starlet sea ane...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap