Conserved Protein Domain Family
UDPGT

?
pfam00201: UDPGT 
UDP-glucoronosyl and UDP-glucosyl transferase
Statistics
?
PSSM-Id: 278624
View PSSM: pfam00201
Aligned: 13 rows
Threshold Bit Score: 481.908
Threshold Setting Gi: 136743
Created: 11-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 549157     24 GKVLVWPMEYSHWMNIKIILEELVQKGHEVTVLRPSAFVFLDPKETSDLKFVTFPTSFSSHDLENFFTrFVNVWTYELPR 103
gi 136743     26 AVLLSIARALAAAAAPSGATLSFLSTASSLAQLRKASSASAGHGLPGNLRFVEVPDGAPAAEETVPVP-RQMQLFMEAAE 104
gi 29839451   26 GKLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMPEVSWQLG--RSLNCTVKTYSTSYTLEDLDREFKaFAHAQWKAQVR 103
gi 136729     28 GKILLIPVDGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIR--DGAFYTLKTYPVPFQREDVKESFVsLGHNVFENDSF 105
gi 2507507    28 GKVLVFPMEGSHWLSMRDVVRELHARGHQAVVLAPEVTVHMK--GEDFFTLQTYAFPYTKEEYQREILgNAKKGFEPQHF 105
gi 549152     29 GKVLVVPIDGSHWLSMREVLRELHARGHQAVVLTPEVNMHIK--EENFFTLTTYAISWTQDEFDRHVLgHTQLYFETEHF 106
gi 29840832   27 DKLLVVPQDGSHWLSMKDIVEVLSDRGHEIVVVVPEVNLLLK--ESKYYTRKIYPVPYDQEELKNRYQsFGNNHFAERSF 104
gi 136732     24 GKVLVWPMDFSHWMNIKIILDELVQRGHEVTVLKPSAYFFLDPKKSSDLKFEIFSTSISKDELQNHFIkLLDVWTYELPR 103
gi 136728     24 GKVLVWPTEYSHWINIKIILNELAQRGHEVTVLVSSASILIEPTKESSINFEIYSVPLSKSDLEYSFAkWIDEWTRDFET 103
gi 332278237  24 GKVLVWPTEYSHWINMKTILEELVQRGHEVTVLTSSASTLVNASKSSAIKLEVYPTSLTKNYLEDSLLkILDRWIYGVSK 103
gi 6175083    24 GKVLVWPTEFSHWMNIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFEDIIKqLVKRWAE-LPK 102
gi 549159     25 GKVLVWPMDFSLWMNLNVILDELVRRGHEVIVLRNSASIFIDPSKQANIKFETFPIAATKDDLEDLFVhYVSTWTN-ARQ 103
gi 549158     25 GKVLVWPMEFSHWMNMKTILDALVQQGHEVTVLRSSASIVIGSNNESGIKFETFHTSYRKDEIENFFMdWFYKMIYNVSI 104
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 549157    104 -DTCLSYFLYLQdtidEYSDYCLTVCkeAVSNKQFMTKLQESKFDVVFSDAIGPcGELIAELLQIPFLYSLRFSPGYTIE 182
gi 136743    105 aGGVKAWLEAAR----AAAGGARVTC--VVGDAFVWPAADAAASAGAPWVPVWT-AASCALLAHIRTDALREDVGDQAAN 177
gi 29839451  104 -SIYSLLMGSYN----DIFDLFFSNCrsLFKDKKLVEYLKESSFDAVFLDPFDNcGLIVAKYFSLPSVVFARGILCHYLE 178
gi 136729    106 lQRVIKTYKKIK----KDSAMLLSGCshLLHNKELMASLAESSFDVMLTDPFLPcSPIVAQYLSLPTVFFLHALPCSLEF 181
gi 2507507   106 vKTFFETMASIK----KFFDLYANSCaaLLHNKTLIQQLNSSSFDVVLTDPVFPcGALLAKYLQIPAVFFLRSVPCGIDY 181
gi 549152    107 lKKFFRSMAMLN----NMSLVYHRSCveLLHNEALIRHLNATSFDVVLTDPVNLcAAVLAKYLSIPTVFFLRNIPCDLDF 182
gi 29840832  105 lTAPQTEYRNNM----IVIGLYFINCqsLLQDRDTLNFFKESKFDALFTDPALPcGVILAEYLGLPSVYLFRGFPCSLEH 180
gi 136732    104 -DTCLSYSPILQnlvyEFSYFYLSICkdAVSNKQLMTKLQESKFDVLFADPVAScGDLIAELLHIPFLYSLSFSPGHKLE 182
gi 136728    104 -LSIWTYYSKMQkvfnEYSDVVENLCkaLIWNKSLMKKLQGSQFDVILADAVGPcGELLAELLKTPLVYSLRFCPGYRCE 182
gi 332278237 104 -NTFWSYFSQLQelcwEYYDYSNKLCkdAVLNKKLMMKLQESKFDVILADALNPcGELLAELFNIPFLYSLRFSVGYTFE 182
gi 6175083   103 -DTFWSYFSQVQeimwTFNDILRKFCkdIVSNKKLMKKLQESRFDVVLADAVFPfGELLAELLKIPFVYSLRFSPGYAIE 181
gi 549159    104 -NSQWKYFSLLQklfsEYSDSCENACkeVVFNKTLMTKLQESRFDILLSDAIGPcGELLAELLKIPFVYSLRFTPGYTME 182
gi 549158    105 -ESYWETFSLTKmvilKYSDICEDICkeVILNKKLMTKLQESRFDVVLADPVSPgGELLAELLKIPLVYSLRGFVGYMLQ 183
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 549157    183 QYIGGVLFPPSYVPMIFSGLAGQMTFIErvHNMICMLYFDFWFQTFREKkwdPFYSKTLGRPTTLAEIMGKAEMWLIRSY 262
gi 136743    178 RVDGLLISHPGLASYRVRDLPDGVVSGD--FNYVINLLVHRMGQCLPRS---AAAVALNTFPGLDPPDVTAALAEILPNC 252
gi 29839451  179 EGA-QCPAPLSYVPRILLGFSDAMTFKErvRNHIMHLEEHLLCHRFFKNa-lEIASEILQTPVTEYDLYSHTSIWLLRTD 256
gi 136729    182 EAT-QCPNPFSYVPRPLSSHSDHMTFLQrvKNMLIAFSQNFLCDVVYSPy-aTLASEFLQREVTVQDLLSSASVWLFRSD 259
gi 2507507   182 EAT-QCPKPSSYIPNLLTMLSDHMTFLQrvKNMLYPLTLKYICHLSITPy-eSLASELLQREMSLVEVLSHASVWLFRGD 259
gi 549152    183 KGT-QCPNPSSYIPRLLTTNSDHMTFMQrvKNMLYPLALSYICHAFSAPy-aSLASELFQREVSVVDILSHASVWLFRGD 260
gi 29840832  181 TFS-RSPDPVSYIPRCYTKFSDHMTFSQrvANFLVNLLEPYLFYCLFSKy-eELASAVLKRDVDIITLYQKVSVWLLRYD 258
gi 136732    183 KSIGKFILPPSYVPVILSGLAGKMTFIDrvKNMICMLYFDFWFERLRHKewdTFYSEILGRPTTVDETMSKVEIWLIRSY 262
gi 136728    183 KFSGGLPLPPSYVPVVLSELSDRMTFVErvKNMLQMLYFDFWFQPFKEKswsQFYSDVLGRPTTLTEMMGKADIWLIRTF 262
gi 332278237 183 KNGGGFLFPPSYVPVVMSELSDQMIFMEriKNMIHMLYFDFWFQIYDLKkwdQFYSEVLGRPTTLFETMGKAEMWLIRTY 262
gi 6175083   182 KHSGGLLFPPSYVPVVMSELSDQMTFIErvKNMIYVLYFEFWFQIFDMKkwdQFYSEVLGRPTTLSETMAKADIWLIRNY 261
gi 549159    183 KYSGGLSVPPSYVPIILSDLSGKMTFMErvNNMLCMLYFDFWFQMFNKKrwdQFYSEVLGRPVTFSELVGKADMWLIRSY 262
gi 549158    184 KHGGGLLLPPSYVPVMMSGLGSQMTFMErvQNLLCVLYFDFWFPKFNEKrwdQFYSEVLGRPVTFLELMGKADMWLIRSY 263
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 549157    263 WDLEfPHPISPnVDYIGGLhCKPAKPLPKDIEDFVQSsgEHGVVVFSLGSMVRNMTEEkANIIAWALAQIPQKVLWRFDG 342
gi 136743    253 VPFG-PYHLLL-AEDDADT-AAPADPHGCLAWLGRQP--ARGVAYVSFGTVACPRPDE-LRELAAGLEDSGAPFLWSLRE 326
gi 29839451  257 FVLDyPKPVMPnMIFIGGInCHQGKPLPMEFEAYINAsgEHGIVVFSLGSMVSEIPEKkAMAIADALGKIPQTVLWRYTG 336
gi 136729    260 FVKDyPRPIMPnMVFVGGInCLHQNPLSQEFEAYINAsgEHGIVVFSLGSMVSEIPEKkAMAIADALGKIPQTVLWRYTG 339
gi 2507507   260 FVFDyPRPIMPnMVFIGGInCVIKKPLSQEFEAYVNAsgEHGIVVFSLGSMVSEIPEKkAMEIAEALGRIPQTLLWRYTG 339
gi 549152    261 FVMDyPRPIMPnMVFIGGInCANRKPLSQEFEAYINAsgEHGIVVFSLGSMVSEIPEKkAMAIADALGKIPQTVLWRYTG 340
gi 29840832  259 FVLEyPRPVMPnMVFIGGInCKKRKDLSQEFEAYINAsgEHGIVVFSLGSMVSEIPEKkAMAIADALGKIPQTVLWRYTG 338
gi 136732    263 WDLKfPHPTLPnVDYIGGLhCKPAKPLPKDMEEFVQSsgEHGVVVFSLGSMVSNMTEEkANAIAWALAQIPQKVLWKFDG 342
gi 136728    263 WDLEfPHPFLPnFDFVGGLhCKPAKPLPREMEEFVQSsgEHGVVVFSLGSMVKNLTEEkANVVASALAQIPQKVVWRFDG 342
gi 332278237 263 WDFEfPRPFLPnVDFVGGLhCKPAKPLPKEMEEFVQSsgENGIVVFSLGSMISNMSEEsANMIASALAQIPQKVLWRFDG 342
gi 6175083   262 WDFQfPHPLLPnVEFVGGLhCKPAKPLPKEMEEFVQSsgENGVVVFSLGSMVSNTSEErANVIASALAKIPQKVLWRFDG 341
gi 549159    263 WDLEfPRPTLPnIQFVGGLhCKPAKPLPKEMEEFVQSsgEEGVVVFSLGSMVSNMTEErANLIASAFAQLPQKVIWRFDG 342
gi 549158    264 WDLEfPRPLLPnFDFIGGLhCKPAKPLPQEMEDFVQSsgEEGVVVFSLGSMISNLTEErANVIASALAQLPQKVLWRFEG 343
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 549157    343 -----KKPPTLGPNT-----RLYKWLPQNDLLGHPKTKAFVTHGGANGIYEAIHHGIPMIGIPLFAEQHDNIAHMVAKGA 412
gi 136743    327 dswphLPPGFLDRAAgtgsgLVVPWAPQVAVLRHPSVGAFVTHAGWASVLEGLSSGVPMACRPFFGDQRMNARSVAHVWG 406
gi 29839451  337 -----TRPSNLANNT-----ILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGA 406
gi 136729    340 -----TRPSNLANNT-----ILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGA 409
gi 2507507   340 -----TRPSNLAKNT-----ILVKWLPQNDLLGHPKARAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGA 409
gi 549152    341 -----TRPSNLANNT-----ILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGA 410
gi 29840832  339 -----TRPSNLANNT-----ILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGA 408
gi 136732    343 -----KTPATLGPNT-----RVYKWLPQNDLLGHPKTKAFVTHGGANGLYEAIYHGIPMIGIPLFGDQPDNIAHMVAKGA 412
gi 136728    343 -----KKPDTLGSNT-----RLYKWIPQNDLLGHPKTKAFVAHGGTNGIYEAIYHGIPIVGIPLFADQPDNINHMVAKGA 412
gi 332278237 343 -----KKPNTLGSNT-----RLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGA 412
gi 6175083   342 -----NKPDTLGLNT-----RLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGVPLFADQPDNIAHMKAKGA 411
gi 549159    343 -----QKPETLGPNT-----RIYDWIPQNDLLGHPKTKAFVTHGGANGIYEAIHHGIPMVGLPLFGEQPDNIAHMTAKGA 412
gi 549158    344 -----KKPDMLGSNT-----RLYKWIPQNDLLGHPKTKAFITHGGANGVFEAIYHGIPMVGLPLFGDQLDNIVYMKAKGA 413
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 549157    413 AVEVNFRTMSKSDLLNALEEVIDNPfykknamwlstihhdqptkpldravfwiefvmrhKGAKhLRSLGHnlpwyqyhsl 492
gi 136743    407 FGAAFEGAMTSAGVATAVEELLRGE----------------------------------EGAR-MRARAK---------- 441
gi 29839451  407 GVTLNVLEMTSEDLENALKAVINDKsykenimrlsslhkdrpvepldlavfwvefvmrhKGAPhLRPAAHdltwyqyhsl 486
gi 136729    410 GVTLNVLEMTSEDLENALKAVINDKsykenimrlsslhkdrpvepldlavfwvefvmrhKGAPhLRPAAHdltwyqyhsl 489
gi 2507507   410 GVTLNVLEMTADDLENALKTVINNKsykenimrlsslhkdrpiepldlavfwveyvmrhKGAPhLRPAAHdltwyqyhsl 489
gi 549152    411 GVTLNVLEMTSEDLENALKAVINDKsykenimrlsslhkdrpvepldlavfwvefvmrhKGAPhLRPAAHdltwyqyhsl 490
gi 29840832  409 GVTLNVLEMTSEDLENALKAVINDKsykenimrlsslhkdrpvepldlavfwvefvmrhKGAPhLRPAAHdltwyqyhsl 488
gi 136732    413 AVSLNIRTMSKLDFLSALEEVIDNPfykknvmllstihhdqpmkpldravfwiefimrhKGAKhLRPLGHnlpwyqyhsl 492
gi 136728    413 AVRVDFSILSTTGLLTALKIVMNDPsykenamrlsrihhdqpvkpldravfwieyvmrhKGAKhLRSTLHdlswfqyhsl 492
gi 332278237 413 ALSVDIRTMSSRDLLNALKSVINDPvykenvmklsrihhdqpmkpldravfwiefvmrhKGAKhLRVAAHnltwiqyhsl 492
gi 6175083   412 AVSLDFHTMSSTDLLNALKTVINDPlykenamklsrihhdqpvkpldravfwiefvmrhKGAKhLRVAAHdltwfqyhsl 491
gi 549159    413 AIRLNWKTMSSEDLLNALKTVINDPsykenvmtlssihhdqpmkpldravfwieyvmrhKGAKhLRVAAHdltwfqyhsl 492
gi 549158    414 AVKLNLKTMSSADLLNALKTVINDPsykenamtlsrihhdqpmkpldravfwieyvmrhKGAKhLRVAAHdltwyqyhsl 493
                        490       500       510
                 ....*....|....*....|....*....|....*
gi 549157    493 dvigfLLSCVAVTVVLALKCFLFVYRFFVKKEKKT 527
gi 136743    442 -----ELQALVAEAFGPGGECRKNFDRFVEIVCRA 471
gi 29839451  487 dvigfLLAVVLTVAFITFKCCAYGYRKCLGKKGRV 521
gi 136729    490 dvigfLLAVVLTVAFITFKCCAYGYRKCLGKKGRV 524
gi 2507507   490 dvigfLLAIVLTVVFIVYKSCAYGCRKCFGGKGRV 524
gi 549152    491 dvigfLLAVVLTVAFITFKCCAYGYRKCLGKKGRV 525
gi 29840832  489 dvigfLLAVVLTVAFITFKCCAYGYRKCLGKKGRV 523
gi 136732    493 dvigfLLTCFAVIAALTVKCLLFMYRFFVKKEKKM 527
gi 136728    493 dvigfLLLCVVGVVFIITKFCLFCCRKTANMGKKK 527
gi 332278237 493 dviafLLACVATVIFIITKFCLFCFRKLAKKGKKK 527
gi 6175083   492 dvtgfLLACVATVIFIITK-CLFCVWKFVRTGKKG 525
gi 549159    493 dvvgfLVSCAAFLIFLVIKSYLFVYQKLVKIGKKQ 527
gi 549158    494 dvigfLLACVAITTYLIVKCCLLVYRYVLGAGKKK 528
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap