Conserved Protein Domain Family
Chal_sti_synt_N

?
pfam00195: Chal_sti_synt_N 
Chalcone and stilbene synthases, N-terminal domain
The C-terminal domain of Chalcone synthase is reported to be structurally similar to domains in thiolase and beta-ketoacyl synthase. The differences in activity are accounted for by differences in this N-terminal domain.
Statistics
?
PSSM-Id: 306663
View PSSM: pfam00195
Aligned: 5 rows
Threshold Bit Score: 366.478
Threshold Setting Gi: 75295925
Created: 11-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8W3P6     8 RNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHkTELKEKFKRMCDKSMIKKRYMHLTEEILKENPNVCEYM 87  wine grape
O23674    17 TRRVANAGKATLLALGKAFPSQVVPQENLVEGFLRDTKCDD-AFIKEKLEHLCKTTTVKTRYTVLTREILAKYPELTTEG 95  thale cress
Q7X795    15 SRSQCSRGKAMLLALGKGLPEQVLPQEKVVETYLQDTICDD-PATRAKLERLCKTTTVRTRYTVMSKELLDEHPELRTEG 93  Japanese rice
ACN81821   8 RNAQRAKGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHmTELKKKFNRICDKSMIKKRYIHLTEEMLEEHPNIGAYM 87  wine grape
Q96562    10 RMAQRAEGLATVLAIGTAVPANCVYQATYPDYYFRVTKSEHlADLKEKFQRMCDKSMIRKRHMHLTEEILIKNPKICAHM 89  Hordeum vulgare
Q8W3P6    88 AASLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAG 167 wine grape
O23674    96 SPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSSSEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGG 175 thale cress
Q7X795    94 TPTLTPRLDICNAAVLELGATAARAALGEWGRPAADITHLVYISSSELRLPGGDLFLATRLGLHPNTVRTSLLFLGCSGG 173 Japanese rice
ACN81821  88 APSLNIRQEIITAEVPRLGRDAALKALKEWGQPKSKITHLVFCTTSGVEMPGADYKLANLLGLETSVRRVMLYHQGCYAG 167 wine grape
Q96562    90 ETSLDARHAIALVEVPKLGQGAAEKAIKEWGQPLSKITHLVFCTTSGVDMPGADYQLTKLLGLSPTVKRLMMYQQGCFGG 169 Hordeum vulgare
Q8W3P6   168 GTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDP 228 wine grape
O23674   176 VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP 236 thale cress
Q7X795   174 AAALRTAKDIAENNPGSRVLVVAAETTVLGFRPPSPDRPYDLVGAALFGDGASAAIIGAGP 234 Japanese rice
ACN81821 168 GTVLRTAKDLAENNAGARVLVVCSEITVVTFRGPSEDALDSLVGQALFGDGSSAVIVGSDP 228 wine grape
Q96562   170 ATVLRLAKDIAENNRGARVLVVCSEITAMAFRGPCKSHLDSLVGHALFGDGAAAAIIGADP 230 Hordeum vulgare
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap