Conserved Protein Domain Family
SNF2_N

?
pfam00176: SNF2_N 
SNF2 family N-terminal domain
This domain is found in proteins involved in a variety of processes including transcription regulation (e.g., SNF2, STH1, brahma, MOT1), DNA repair (e.g., ERCC6, RAD16, RAD5), DNA recombination (e.g., RAD54), and chromatin unwinding (e.g., ISWI) as well as a variety of other proteins with little functional information (e.g., lodestar, ETL1).
Statistics
?
PSSM-Id: 306645
View PSSM: pfam00176
Aligned: 19 rows
Threshold Bit Score: 187.604
Threshold Setting Gi: 937900272
Created: 13-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P34739        442 HQKHALAWMswre-----------------------------------------------------------rklpRGGI 462  fruit fly
P40352        300 YQKTCVQWLyely------------------------------------------------------------qqnCGGI 319  Saccharomyces...
Q03468        510 YQQTGVRWLwelh------------------------------------------------------------cqqAGGI 529  human
P46100       1563 HQVDGVQFMwdcccesv---------------------------------------------------kktkkspgSGCI 1591 human
P41410        267 HQIEGVKFLykcvtg-------------------------------------------------------ridrcaNGCI 291  Schizosacchar...
P38086        299 HQREGVKFMydclmglarptienpd-----------------------------------idcttkslvlendsdiSGCL 343  Saccharomyces...
XP_004935641  310 YQSEAVNWMlhrenftntpenalhflwrevitld------------------gvkiyynpftgcvireypfagpqwPGGI 371  chicken
BAS76252       97 HQEAAVEWMlrreqnlqvlehplykglctmdg---------------------fpyyinvtsgeistgsaptvhdfCGGM 155  Japanese rice
XP_001743850  741 HQIRSVKWMrareaglhgrfdspqhmpvaarfvqhqe------------rhgwqhiffvdaetgnvepspetrqssRGGL 808  Monosiga brev...
CBJ27911      227 HQKEGLAWMvqrennpdpngarlddgkknnpdsngkgcqshssglppfweqrveggkgvfhntitcssqpcrpasvHGGI 306  Ectocarpus si...
P34739        463 LADDMGLGKT---------------------------------------------------------------------- 472  fruit fly
P40352        320 IGDEMGLGKT---------------------------------------------------------------------- 329  Saccharomyces...
Q03468        530 LGDEMGLGKT---------------------------------------------------------------------- 539  human
P46100       1592 LAHCMGLGKT---------------------------------------------------------------------- 1601 human
P41410        292 MADEMGLGKT---------------------------------------------------------------------- 301  Schizosacchar...
P38086        344 LADDMGLGKT---------------------------------------------------------------------- 353  Saccharomyces...
XP_004935641  372 LADEMGLGKT---------------------------------------------------------------------- 381  chicken
BAS76252      156 FCDEPGLGKT---------------------------------------------------------------------- 165  Japanese rice
XP_001743850  809 LCDDPAATETdplpaeksttkpstlrnlafrrfmkeearmrgiderlfdepvdlslypdythtvtrpiavrnirdrhyts 888  Monosiga brev...
CBJ27911      307 LSDDMGLGKT---------------------------------------------------------------------- 316  Ectocarpus si...
P34739        473 -----------------------LTMISSVLackngqems---------------------------------------- 489  fruit fly
P40352        330 -----------------------IQVIAFIA------------------------------------------------- 337  Saccharomyces...
Q03468        540 -----------------------IQIIAFLA------------------------------------------------- 547  human
P46100       1602 -----------------------LQVVSFLHtvllcd------------------------------------------- 1615 human
P41410        302 -----------------------LQCIALLWtllkqspq----------------------------------------- 317  Schizosacchar...
P38086        354 -----------------------LMSITLIWtlirqtpfaskvs------------------------------------ 374  Saccharomyces...
XP_004935641  382 -----------------------VEVLALILthtredikqddltlpegelvnffvppqpsqgskkkktremelklkekiq 438  chicken
BAS76252      166 -----------------------VTALSLILkthg--------------------------------------------- 177  Japanese rice
XP_001743850  889 fqalyddlqlmlangaqynhgtpIQELCLVLqq----------------------------------------------- 921  Monosiga brev...
CBJ27911      317 -----------------------LQVISLILaq----------------------------------------------- 326  Ectocarpus si...
P34739        490 -------------------------------------------------------------------egkdessdSDSED 502  fruit fly
P40352        338 ---------------------------------------------------------------------------ALHHS 342  Saccharomyces...
Q03468        548 ---------------------------------------------------------------------------GLSYS 552  human
P46100       1616 ----------------------------------------------------------------------kldfsT---- 1621 human
P41410        318 --------------------------------------------------------------------agkptieK---- 325  Schizosacchar...
P38086        375 --------------------------------------------------------------csqsgipltglckK---- 388  Saccharomyces...
XP_004935641  439 ypslrvmvlaavkemnvkkgasifaifkyisavyrydiqrnrrllkrtlekliaeqvveqvkghglagsfklgknYKEQK 518  chicken
BAS76252          -------------------------------------------------------------------------------- Japanese rice
XP_001743850  922 --------------------------------------------------------------------------rLHEHI 927  Monosiga brev...
CBJ27911      327 --------------------------------------------------------------------------pPAGTD 332  Ectocarpus si...
P34739        503 DKNKkrksvtgwkskgrkdtrrGG-------------------------------------------------------- 526  fruit fly
P40352        343 GLLT------------------GP-------------------------------------------------------- 348  Saccharomyces...
Q03468        553 KIRTrgsny--------rfeglGP-------------------------------------------------------- 568  human
P46100            -------------------------------------------------------------------------------- human
P41410            -------------------------------------------------------------------------------- Schizosacchar...
P38086            -------------------------------------------------------------------------------- Saccharomyces...
XP_004935641  519 RRERtkeqaaktseriqkkqlsDAntqtneskdsdvtstdvlkiplrtsiateehdycatikndrksetdnensmeenni 598  chicken
BAS76252      178 -------------------tlaVPppgmnvmwcmhkpdkkygyyelsasnssngniflsgskklrkdviredtcssesln 238  Japanese rice
XP_001743850  928 LSLPidrrarrrsgrvdvrpmyNA-------------------------------------------------------- 951  Monosiga brev...
CBJ27911      333 YVKKvlaveankrlkealdrgeTPppqekeltpqqkqeavakkykklkkadlerelaa---------------------- 390  Ectocarpus si...
P34739            -------------------------------------------------------------------------------- fruit fly
P40352            -------------------------------------------------------------------------------- Saccharomyces...
Q03468            -------------------------------------------------------------------------------- human
P46100            -------------------------------------------------------------------------------- human
P41410            -------------------------------------------------------------------------------- Schizosacchar...
P38086            -------------------------------------------------------------------------------- Saccharomyces...
XP_004935641  599 qkaavskspdlhgkplisgdisshsdfdvsksttdv-------------------------------------------- 634  chicken
BAS76252      239 nggsvvstrssrkrgrlvnpdlnmiaahpsgkspmsaptgahstpathvlkitknlkhvrknlmeaysdgsvgnkrkrda 318  Japanese rice
XP_001743850      -------------------------------------------------------------------------------- Monosiga brev...
CBJ27911          -------------------------------------------------------------------------------- Ectocarpus si...
P34739            -------------------------------------------------------------------------------- fruit fly
P40352            -------------------------------------------------------------------------------- Saccharomyces...
Q03468            -------------------------------------------------------------------------------- human
P46100            -------------------------------------------------------------------------------- human
P41410            -------------------------------------------------------------------------------- Schizosacchar...
P38086            -------------------------------------------------------------------------------- Saccharomyces...
XP_004935641      -------------------------------------------------------------------------------- chicken
BAS76252      319 tselsetwvqcdacrkwrrlldgtaldsstawfcsmnpdsarqkcsipeeswdlkrkitylpgfhkkgtppgneqnasff 398  Japanese rice
XP_001743850      -------------------------------------------------------------------------------- Monosiga brev...
CBJ27911          -------------------------------------------------------------------------------- Ectocarpus si...
P34739            -------------------------------------------------------------------------------- fruit fly
P40352            -------------------------------------------------------------------------------- Saccharomyces...
Q03468            -------------------------------------------------------------------------------- human
P46100            -------------------------------------------------------------------------------- human
P41410            -------------------------------------------------------------------------------- Schizosacchar...
P38086            -------------------------------------------------------------------------------- Saccharomyces...
XP_004935641  635 ------------------qqemprsshsqehasgsvqrtssvfpfntseyrfecicgelglvdykarvqclkchlwqhae 696  chicken
BAS76252      399 tnilkehaalidsetmkallwlaklspkkhiemeavgltrpvldaranigkgarpyykifqafglvrkvekgitrwyyps 478  Japanese rice
XP_001743850      -------------------------------------------------------------------------------- Monosiga brev...
CBJ27911      391 -----------------------------------------------------------------------------kgl 393  Ectocarpus si...
P34739        527 ------------------------------TLVVCPA-SLLRQWESEVESKVSRQKLTVCVHHG---------------- 559  fruit fly
P40352        349 ------------------------------VLIVCPA-TVMKQWCNEFQHWWPPLRTVILHSMGsgmasdqkfkmdendl 397  Saccharomyces...
Q03468        569 ------------------------------TVIVCPT-TVMHQWVKEFHTWWPPFRVAILHETGsy-------------- 603  human
P46100       1622 ------------------------------ALVVCPL-NTALNWMNEFEKWQEGLK-------Ddeklevse-------- 1655 human
P41410        326 ------------------------------AIITCPS-SLVKNWANELVKWLGKDAITPFILDGksskqe---------- 364  Schizosacchar...
P38086        389 ------------------------------ILVVCPV-TLIGNWKREFGKWLNLSRIGVLTLSSrnsp------------ 425  Saccharomyces...
XP_004935641  697 cvnykeenlkikpfycphclvamkpvstgaTLIISPS-SICHQWVDEINRHVRSSSLRVLVYQGv--------------- 760  chicken
BAS76252      479 mlddlafdsaalgialekpldlvrlylsraTLIVVPA-NLIDHWTTQIQRHVSSDTLNVYVWGDhk-------------- 543  Japanese rice
XP_001743850  952 ------------------------------TLIIAPTlDLARHWEHEIDAYTAGPHV------Lgrt------------- 982  Monosiga brev...
CBJ27911      394 dtkgnkndlvgrlstheagltpvdpsvklgTLVVCPM-SVIHNWETQFAEHVKEGALDVYAYHG---------------- 456  Ectocarpus si...
P34739        560 -------------------------------NnretkgkYLRDYDIVVTTYQIVAREHks-------------------- 588  fruit fly
P40352        398 enlimnskpsdfsyedwknstrtkkalessyHldklidkVVTDGHILITTYVGLRIHS---------------------- 455  Saccharomyces...
Q03468        604 -----------------------------thKkeklirdVAHCHGILITSYSYIRLMQ---------------------- 632  human
P46100       1656 -----------------------latvkrpqErsymlqrWQEDGGVMIIGYEMYRNLAqgrnvksr-----------klk 1701 human
P41410        365 --------------------------limalQqwasvhgRQVTRPVLIASYETLRSYV---------------------- 396  Schizosacchar...
P38086        426 ---------------------------dmdkMavrnflkVQRTYQVLIIGYEKLLSVS---------------------- 456  Saccharomyces...
XP_004935641  761 ------------------------------kKhgflqphMLAEQDVVITTYDVLRTELnyvdiphsnsedgrrfrnqkry 810  chicken
BAS76252      544 -----------------------------kpSah----nLAWDYDIVITTFSRLS--Aewgp------------------ 570  Japanese rice
XP_001743850  983 ----------------------------cmlLntrvlpeTFEDYGVVITTLHTLSRVCslp------------------- 1015 Monosiga brev...
CBJ27911      457 -------------------------------GnrnqdptFLATKDVVITTYDTLA--Sdfsasggqkaleedvtaavggk 503  Ectocarpus si...
P34739        589 ---lSAVFGVK--WRRIILDEAHVVRNH---KSQSSLAVCDLRGKYRWALTGTPIQN----KELDVY-ALLKFLRCSPFD 655  fruit fly
P40352        456 ----DKLLKVK--WQYAVLDEGHKIRNP---DSEISLTCKKLKTHNRIILSGTPIQN----NLTELW-SLFDFIFPGKLG 521  Saccharomyces...
Q03468        633 ----DDISRYD--WHYVILDEGHKIRNP---NAAVTLACKQFRTPHRIILSGSPMQN----NLRELW-SLFDFIFPGKLG 698  human
P46100       1702 eifnKALVDPG--PDFVVCDEGHILKNE---ASAVSKAMNSIRSRRRIILTGTPLQN----NLIEYH-CMVNFIKENLLG 1771 human
P41410        397 ----EHLNNAE--IGMLLCDEGHRLKNS---DSLTFTALDKLNVQRRVILSGTPIQN----DLSEYF-SLLNFANPGLLG 462  Schizosacchar...
P38086        457 ----EELEKNKhlIDMLVCDEGHRLKNG---ASKILNTLKSLDIRRKLLLTGTPIQN----DLNEFF-TIIDFINPGILG 524  Saccharomyces...
XP_004935641  811 maipSPLVAVE--WWRICLDEAQMVECT---TAKAAEMALRLSGINRWCVSGTPVQR----GLEDLY-GLVLFLGIDPYW 880  chicken
BAS76252      571 -kkrSVLKQIH--WFRVILDEGHTLGSSlalTNKLQMAVS-LVASNRWILTGTPTPNtptsQVAHLH-PMLKFLHEEVYG 645  Japanese rice
XP_001743850 1016 -hhyDLFHQRR--WHRIVVDEGHTLGKGv--QSRAREAIQSLGTDHMWIVSGTPTPDllasSGIDFIrGLLITLREPPFC 1090 Monosiga brev...
CBJ27911      504 pkrrHGVGGLG--GNRVVLDEAHPFRNN---KTNKHKACLALSSRYRWCLTGTPLIN----KPEDIG-ALFSFLHLAPAS 573  Ectocarpus si...
P34739        656 D-LH--TWKKWIDNKSA------------------GGQNRLNLLMKSLMLRRTKAQLqsDGklNsLPNKELRLIEISLDK 714  fruit fly
P40352        522 T-LP--VFQQQFVIPINiggyanat--niqvqtgyKCAVALRDLISPYLLRRVKADV--AK--D-LPQKKEMVLFCKLTK 591  Saccharomyces...
Q03468        699 T-LP--VFMEQFSVPITmggysnas--pvqvktayKCACVLRDTINPYLLRRMKSDVkmSL--S-LPDKNEQVLFCRLTD 770  human
P46100       1772 S-IK--EFRNRFINPIQngqcadst--mvdvrvmkKRAHILYEMLAGCVQRKDYTAL--TK--F-LPPKHEYVLAVRMTS 1841 human
P41410        463 S-RQ--EFRKNYEIPILkgrdadgt--ekdkengdAKLAELAKIVNRFIIRRTNDIL--SK--Y-LPVKYEHVVFCNLSE 532  Schizosacchar...
P38086        525 S-FA--SFKRRFIIPITrardtanryneellekgeERSKEMIEITKRFILRRTNAIL--EK--Y-LPPKTDIILFCKPYS 596  Saccharomyces...
XP_004935641  881 V-KH--WWDQLLYRPYCr-----------------KNSQPLYSLIAKIMWRSAKKDVidQI--Q-IPPQTENIHWLHFSP 937  chicken
BAS76252      646 QnYQ--SWDTGIHRPFEaq--------------meDGRSRLLQLLQRTMISARKQDL---K--N-IPPCIKKITFLDFSE 703  Japanese rice
XP_001743850 1091 EgNTrnTFRNLLTRPFErhl-------------atDSVWRLAQMLQRCMVRHSKLET--MR--N-VPRPVCETILLPLQH 1152 Monosiga brev...
CBJ27911      574 N-PR--VFLQAIGRPIRsg--------------sdAGLARLRVLMKSVCLRRTKSVL--SG--K-LPPKVVEIHRVQMDD 631  Ectocarpus si...
P34739        715 EEMNVYQtvmtysrtlfaqFLHQRAERETDFNYrsdankptynqikdpngayykmhekfarmagskkevkshdILVLLLR 794  fruit fly
P40352        592 YQRSKYL--------------------EFLHSSdlnqiq-----------------------------ngkrnVLFGIDI 622  Saccharomyces...
Q03468        771 EQHKVYQ--------------------NFVDSKevyril-----------------------------ngemqIFSGLIA 801  human
P46100       1842 IQCKLYQyyldhltgvgnnSEGGRGKAGAK-------------------------------------------LFQDFQM 1878 human
P41410        533 FQLSLYKhfitspeinkilRGTGSQ------------------------------------------------PLKAIGL 564  Schizosacchar...
P38086        597 QQILAFKdilqgarldfgqLTFSS-------------------------------------------------SLGLITL 627  Saccharomyces...
XP_004935641  938 VERHFYHrqhevccqdalaKLRKISDWTLKLSSldrr--------------------------------tvtsILYPLLR 985  chicken
BAS76252      704 GHAKSYN------------------------------------------------------------------------E 711  Japanese rice
XP_001743850 1153 HEWRSYNtllsflrgnivlTSLVGNEISGKQDS----------------------------------------ILESPRH 1192 Monosiga brev...
CBJ27911      632 GHREAYN------------TLFNSARAAFKAALadgeaev---------------------------msqyasVLECLLR 672  Ectocarpus si...
P34739        795 LRQICCHPGLI 805  fruit fly
P40352        623 LRKICNHPDLL 633  Saccharomyces cerevisiae S288c
Q03468        802 LRKICNHPDLF 812  human
P46100       1879 LSRIWTHPWCL 1889 human
P41410        565 LKKICNHPDLL 575  Schizosaccharomyces pombe 972h-
P38086        628 LKKVCNSPGLV 638  Saccharomyces cerevisiae S288c
XP_004935641  986 LRQACCHPQAV 996  chicken
BAS76252      712 LAVTIRRNILM 722  Japanese rice
XP_001743850 1193 LREAMENLRIi 1203 Monosiga brevicollis MX1
CBJ27911      673 LRQVCCAESLV 683  Ectocarpus siliculosus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap