6KW4,5VVR


Conserved Protein Domain Family
SNF2_N

?
pfam00176: SNF2_N 
Click on image for an interactive view with Cn3D
SNF2 family N-terminal domain
This domain is found in proteins involved in a variety of processes including transcription regulation (e.g., SNF2, STH1, brahma, MOT1), DNA repair (e.g., ERCC6, RAD16, RAD5), DNA recombination (e.g., RAD54), and chromatin unwinding (e.g., ISWI) as well as a variety of other proteins with little functional information (e.g., lodestar, ETL1).
Statistics
?
PSSM-Id: 395124
View PSSM: pfam00176
Aligned: 19 rows
Threshold Bit Score: 186.824
Threshold Setting Gi: 937900272
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6KW4_Y        473 YQLRGLEWMvsly------------------------------------------------------------------- 485  Saccharomyces...
P34739        442 HQKHALAWMswre------------------------------------------------------------------- 454  fruit fly
CBJ27911      227 HQKEGLAWMvqrennpdpngarlddgkknnpdsngkgcqshss------------------------------------- 269  Ectocarpus si...
XP_002947308  217 YQRRAVAWMlrreqvvlereqndedttaaatgfnsgkggaeqrgeaaqvqppqgreamdwdaavavaaargpasadvqeg 296  Volvox carter...
Q03468        510 YQQTGVRWLwelh------------------------------------------------------------------- 522  human
P46100       1563 HQVDGVQFMwdcccesv--------------------------------------------------------------- 1579 human
P41410        267 HQIEGVKFLykcvtg----------------------------------------------------------------- 281  Schizosacchar...
P38086        299 HQREGVKFMydclmglarptienpd------------------------------------------------------- 323  Saccharomyces...
EDQ91428      741 HQIRSVKWMrareaglhgrfdspqhmpvaarfvqhqe------------------------------------------- 777  Monosiga brev...
BAS76252       97 HQEAAVEWMlrreqnlqvlehplykglctmdg------------------------------------------------ 128  Japanese rice
6KW4_Y        486 ---------------------------------------------nnhLNGILADEMGLGKT------------------ 502  Saccharomyces...
P34739        455 --------------------------------------------rklpRGGILADDMGLGKT------------------ 472  fruit fly
CBJ27911      270 ---------------glppfweqrveggkgvfhntitcssqpcrpasvHGGILSDDMGLGKT------------------ 316  Ectocarpus si...
XP_002947308  297 gdlraaapplhplwrrlrtlpgsaaeavyvnpytgalaavpfpapqpvRGGILADEMGLGKT------------------ 358  Volvox carter...
Q03468        523 ---------------------------------------------cqqAGGILGDEMGLGKT------------------ 539  human
P46100       1580 ----------------------------------------kktkkspgSGCILAHCMGLGKT------------------ 1601 human
P41410        282 ------------------------------------------ridrcaNGCIMADEMGLGKT------------------ 301  Schizosacchar...
P38086        324 --------------------------------idcttkslvlendsdiSGCLLADDMGLGKT------------------ 353  Saccharomyces...
EDQ91428      778 ---------------------rhgwqhiffvdaetgnvepspetrqssRGGLLCDDPAATETdplpaeksttkpstlrnl 836  Monosiga brev...
BAS76252      129 -------------------------fpyyinvtsgeistgsaptvhdfCGGMFCDEPGLGKT------------------ 165  Japanese rice
6KW4_Y        503 ---------------------------------------------------------------------------IQSIS 507  Saccharomyces...
P34739        473 ---------------------------------------------------------------------------LTMIS 477  fruit fly
CBJ27911      317 ---------------------------------------------------------------------------LQVIS 321  Ectocarpus si...
XP_002947308  359 ---------------------------------------------------------------------------VELLA 363  Volvox carter...
Q03468        540 ---------------------------------------------------------------------------IQIIA 544  human
P46100       1602 ---------------------------------------------------------------------------LQVVS 1606 human
P41410        302 ---------------------------------------------------------------------------LQCIA 306  Schizosacchar...
P38086        354 ---------------------------------------------------------------------------LMSIT 358  Saccharomyces...
EDQ91428      837 afrrfmkeearmrgiderlfdepvdlslypdythtvtrpiavrnirdrhytsfqalyddlqlmlangaqynhgtpIQELC 916  Monosiga brev...
BAS76252      166 ---------------------------------------------------------------------------VTALS 170  Japanese rice
6KW4_Y        508 LIT--------------------------YLYEVKKDI------------------GP---------------------- 521  Saccharomyces...
P34739        478 SVLackngqems---------egkdessdSDSEDDKNKkrksvtgwkskgrkdtrrGG---------------------- 526  fruit fly
CBJ27911      322 LILaq-----------------------pPAGTDYVKKvlaveankrlkealdrgeTPppqekeltpqqkqeavakkykk 378  Ectocarpus si...
XP_002947308  364 LITanrfgpksq---------pgmaplvaAGQALDPAAaaaaaaggraknrkdwalFPgggaivkwlkcerdeplldsav 434  Volvox carter...
Q03468        545 FLA--------------------------GLSYSKIRTrgsny--------rfeglGP---------------------- 568  human
P46100       1607 FLHtvllcd---------------kldfsT-------------------------------------------------- 1621 human
P41410        307 LLWtllkqspq-----------agkptieK-------------------------------------------------- 325  Schizosacchar...
P38086        359 LIWtlirqtpfaskvscsqsgipltglckK-------------------------------------------------- 388  Saccharomyces...
EDQ91428      917 LVLqq-----------------------rLHEHILSLPidrrarrrsgrvdvrpmyNA---------------------- 951  Monosiga brev...
BAS76252      171 LILkthg----------------------------------------------tlaVPppgmnvmwcmhkpdkkygyyel 204  Japanese rice
6KW4_Y            --------------------------------------------------------------------------------      Saccharomyces...
P34739            --------------------------------------------------------------------------------      fruit fly
CBJ27911      379 lkkadlerelaa-------------------------------------------------------------------- 390  Ectocarpus si...
XP_002947308  435 ygcrsmwgrryngggvggtvqptspaaavaaarqrlpervdcpc------------------------------------ 478  Volvox carter...
Q03468            --------------------------------------------------------------------------------      human
P46100            --------------------------------------------------------------------------------      human
P41410            --------------------------------------------------------------------------------      Schizosacchar...
P38086            --------------------------------------------------------------------------------      Saccharomyces...
EDQ91428          --------------------------------------------------------------------------------      Monosiga brev...
BAS76252      205 sasnssngniflsgskklrkdviredtcsseslnnggsvvstrssrkrgrlvnpdlnmiaahpsgkspmsaptgahstpa 284  Japanese rice
6KW4_Y            --------------------------------------------------------------------------------      Saccharomyces...
P34739            --------------------------------------------------------------------------------      fruit fly
CBJ27911          --------------------------------------------------------------------------------      Ectocarpus si...
XP_002947308      --------------------------------------------------------------------------------      Volvox carter...
Q03468            --------------------------------------------------------------------------------      human
P46100            --------------------------------------------------------------------------------      human
P41410            --------------------------------------------------------------------------------      Schizosacchar...
P38086            --------------------------------------------------------------------------------      Saccharomyces...
EDQ91428          --------------------------------------------------------------------------------      Monosiga brev...
BAS76252      285 thvlkitknlkhvrknlmeaysdgsvgnkrkrdatselsetwvqcdacrkwrrlldgtaldsstawfcsmnpdsarqkcs 364  Japanese rice
6KW4_Y            --------------------------------------------------------------------------------      Saccharomyces...
P34739            --------------------------------------------------------------------------------      fruit fly
CBJ27911          --------------------------------------------------------------------------------      Ectocarpus si...
XP_002947308  479 ------------------------------------------------------------------------------gv 480  Volvox carter...
Q03468            --------------------------------------------------------------------------------      human
P46100            --------------------------------------------------------------------------------      human
P41410            --------------------------------------------------------------------------------      Schizosacchar...
P38086            --------------------------------------------------------------------------------      Saccharomyces...
EDQ91428          --------------------------------------------------------------------------------      Monosiga brev...
BAS76252      365 ipeeswdlkrkitylpgfhkkgtppgneqnasfftnilkehaalidsetmkallwlaklspkkhiemeavgltrpvldar 444  Japanese rice
6KW4_Y        522 ----------------------------------------------------------------FLVIVPL-STITNWTL 536  Saccharomyces...
P34739        527 ----------------------------------------------------------------TLVVCPA-SLLRQWES 541  fruit fly
CBJ27911      391 -------------------------------kgldtkgnkndlvgrlstheagltpvdpsvklgTLVVCPM-SVIHNWET 438  Ectocarpus si...
XP_002947308  481 raddphdpdveeyeglwilcegcnawmhgacvgvkrspqrsaawvcsrclraralapvsepcgaTLIVVPS-AILQQWYD 559  Volvox carter...
Q03468        569 ----------------------------------------------------------------TVIVCPT-TVMHQWVK 583  human
P46100       1622 ----------------------------------------------------------------ALVVCPL-NTALNWMN 1636 human
P41410        326 ----------------------------------------------------------------AIITCPS-SLVKNWAN 340  Schizosacchar...
P38086        389 ----------------------------------------------------------------ILVVCPV-TLIGNWKR 403  Saccharomyces...
EDQ91428      952 ----------------------------------------------------------------TLIIAPTlDLARHWEH 967  Monosiga brev...
BAS76252      445 anigkgarpyykifqafglvrkvekgitrwyypsmlddlafdsaalgialekpldlvrlylsraTLIVVPA-NLIDHWTT 523  Japanese rice
6KW4_Y        537 EFEKWAPSLNTIIYKGTPnqrhs--------------------------------------------------------- 559  Saccharomyces...
P34739        542 EVESKVSRQKLTVCVHHG-------------------------------------------------------------- 559  fruit fly
CBJ27911      439 QFAEHVKEGALDVYAYHG-------------------------------------------------------------- 456  Ectocarpus si...
XP_002947308  560 EIRRHVHPGALRVVVYGGqtqpgvsgsgalicsgtftpgrvggtavtcgtaaapgglrgpadrgvdgdgnfsvveadvae 639  Volvox carter...
Q03468        584 EFHTWWPPFRVAILHETGsy------------------------------------------------------------ 603  human
P46100       1637 EFEKWQEGLK-------Ddeklevse--------------------------------------------------latv 1659 human
P41410        341 ELVKWLGKDAITPFILDGksskqe-------------------------------------------------------l 365  Schizosacchar...
P38086        404 EFGKWLNLSRIGVLTLSSrnsp---------------------------------------------------------- 425  Saccharomyces...
EDQ91428      968 EIDAYTAGPHV------Lgrt----------------------------------------------------------- 982  Monosiga brev...
BAS76252      524 QIQRHVSSDTLNVYVWGDhk------------------------------------------------------------ 543  Japanese rice
6KW4_Y        560 lqhqI-------RVGNFDVLLTTYEYIIKDK--------------------------SLLSKHD--WAHMIIDEGHRMKN 604  Saccharomyces...
P34739        560 ----NnretkgkYLRDYDIVVTTYQIVAREHks-----------------------lSAVFGVK--WRRIILDEAHVVRN 610  fruit fly
CBJ27911      457 ----GnrnqdptFLATKDVVITTYDTLA--SdfsasggqkaleedvtaavggkpkrrHGVGGLG--GNRVVLDEAHPFRN 528  Ectocarpus si...
XP_002947308  640 smvgRwvvvsaaQLAAADVVLTTYDVLKRDVarqpdpegqers---lrhgkryevvpTPLTRLR--WWRVVLDEAQMVES 714  Volvox carter...
Q03468        604 --thKkeklirdVAHCHGILITSYSYIRLMQ--------------------------DDISRYD--WHYVILDEGHKIRN 653  human
P46100       1660 krpqErsymlqrWQEDGGVMIIGYEMYRNLAqgrnvksr-----------klkeifnKALVDPG--PDFVVCDEGHILKN 1726 human
P41410        366 imalQqwasvhgRQVTRPVLIASYETLRSYV--------------------------EHLNNAE--IGMLLCDEGHRLKN 417  Schizosacchar...
P38086        426 dmdkMavrnflkVQRTYQVLIIGYEKLLSVS--------------------------EELEKNKhlIDMLVCDEGHRLKN 479  Saccharomyces...
EDQ91428      983 -cmlLntrvlpeTFEDYGVVITTLHTLSRVCslp--------------------hhyDLFHQRR--WHRIVVDEGHTLGK 1039 Monosiga brev...
BAS76252      544 --kpSah----nLAWDYDIVITTFSRLS--Aewgp-------------------kkrSVLKQIH--WFRVILDEGHTLGS 594  Japanese rice
6KW4_Y        605 A---QSKLSFTISHyYRTRNRLILTGTPLQN----NLPELW-ALLNFVLPKIFNS-AK--TFEDWFNTPFAntgtqekl- 672  Saccharomyces...
P34739        611 H---KSQSSLAVCD-LRGKYRWALTGTPIQN----KELDVY-ALLKFLRCSPFDD-LH--TWKKWIDNKSA--------- 669  fruit fly
CBJ27911      529 N---KTNKHKACLA-LSSRYRWCLTGTPLIN----KPEDIG-ALFSFLHLAPASN-PR--VFLQAIGRPIRsg------- 589  Ectocarpus si...
XP_002947308  715 S---TAKAAEMALK-LDTVHRWCVTGTPISR----GLEDVY-GLLAFLGVRPWTE-RR--WWSRCVQRPAEac------- 775  Volvox carter...
Q03468        654 P---NAAVTLACKQ-FRTPHRIILSGSPMQN----NLRELW-SLFDFIFPGKLGT-LP--VFMEQFSVPITmggysnas- 720  human
P46100       1727 E---ASAVSKAMNS-IRSRRRIILTGTPLQN----NLIEYH-CMVNFIKENLLGS-IK--EFRNRFINPIQngqcadst- 1793 human
P41410        418 S---DSLTFTALDK-LNVQRRVILSGTPIQN----DLSEYF-SLLNFANPGLLGS-RQ--EFRKNYEIPILkgrdadgt- 484  Schizosacchar...
P38086        480 G---ASKILNTLKS-LDIRRKLLLTGTPIQN----DLNEFF-TIIDFINPGILGS-FA--SFKRRFIIPITrardtanry 547  Saccharomyces...
EDQ91428     1040 Gv--QSRAREAIQS-LGTDHMWIVSGTPTPDllasSGIDFIrGLLITLREPPFCEgNTrnTFRNLLTRPFErhl------ 1110 Monosiga brev...
BAS76252      595 SlalTNKLQMAVS--LVASNRWILTGTPTPNtptsQVAHLH-PMLKFLHEEVYGQnYQ--SWDTGIHRPFEaq------- 662  Japanese rice
6KW4_Y        673 -elteeetlLIIRRLHKVLRP----------------------FLLRRLKKEV--EK--D-LPDKVEKVIKCKLSGLQQQ 724  Saccharomyces...
P34739        670 ---------GGQNRLNLLMKS----------------------LMLRRTKAQLqsDGklNsLPNKELRLIEISLDKEEMN 718  fruit fly
CBJ27911      590 -------sdAGLARLRVLMKS----------------------VCLRRTKSVL--SG--K-LPPKVVEIHRVQMDDGHRE 635  Ectocarpus si...
XP_002947308  776 -------dpEGRRLLLHLLRPsravgdcaagsggggggggdggLMWRSAKRDVesEL--G-LPPQSTHLRHLRLNAVELH 845  Volvox carter...
Q03468        721 -pvqvktayKCACVLRDTINP----------------------YLLRRMKSDVkmSL--S-LPDKNEQVLFCRLTDEQHK 774  human
P46100       1794 -mvdvrvmkKRAHILYEMLAG----------------------CVQRKDYTAL--TK--F-LPPKHEYVLAVRMTSIQCK 1845 human
P41410        485 -ekdkengdAKLAELAKIVNR----------------------FIIRRTNDIL--SK--Y-LPVKYEHVVFCNLSEFQLS 536  Schizosacchar...
P38086        548 neellekgeERSKEMIEITKR----------------------FILRRTNAIL--EK--Y-LPPKTDIILFCKPYSQQIL 600  Saccharomyces...
EDQ91428     1111 -------atDSVWRLAQMLQR----------------------CMVRHSKLET--MR--N-VPRPVCETILLPLQHHEWR 1156 Monosiga brev...
BAS76252      663 -------meDGRSRLLQLLQR----------------------TMISARKQDL---K--N-IPPCIKKITFLDFSEGHAK 707  Japanese rice
6KW4_Y        725 LYQ------------QMLKHNALFVGAGTegatk------------------------------ggikgLNNKIMQLRKI 762  Saccharomyces...
P34739        719 VYQtvmtysrtlfaqFLHQRAERETDFNYrsdankptynqikdpngayykmhekfarmagskkevkshdILVLLLRLRQI 798  fruit fly
CBJ27911      636 AYN------------TLFNSARAAFKAALadgeaev---------------------------msqyasVLECLLRLRQV 676  Ectocarpus si...
XP_002947308  846 FYNrrhqdcatkaraVLPPRVVAAMESGR----------------------------------------LLGYGTEEQQD 885  Volvox carter...
Q03468        775 VYQ--------------------NFVDSKevyril-----------------------------ngemqIFSGLIALRKI 805  human
P46100       1846 LYQyyldhltgvgnnSEGGRGKAGAK-------------------------------------------LFQDFQMLSRI 1882 human
P41410        537 LYKhfitspeinkilRGTGSQ------------------------------------------------PLKAIGLLKKI 568  Schizosacchar...
P38086        601 AFKdilqgarldfgqLTFSS-------------------------------------------------SLGLITLLKKV 631  Saccharomyces...
EDQ91428     1157 SYNtllsflrgnivlTSLVGNEISGKQDS----------------------------------------ILESPRHLREA 1196 Monosiga brev...
BAS76252      708 SYN------------------------------------------------------------------------ELAVT 715  Japanese rice
6KW4_Y        763 CNHPFVF 769  Saccharomyces cerevisiae S288C
P34739        799 CCHPGLI 805  fruit fly
CBJ27911      677 CCAESLV 683  Ectocarpus siliculosus
XP_002947308  886 QQQDQMT 892  Volvox carteri f. nagariensis
Q03468        806 CNHPDLF 812  human
P46100       1883 WTHPWCL 1889 human
P41410        569 CNHPDLL 575  Schizosaccharomyces pombe 972h-
P38086        632 CNSPGLV 638  Saccharomyces cerevisiae S288C
EDQ91428     1197 MENLRIi 1203 Monosiga brevicollis MX1
BAS76252      716 IRRNILM 722  Japanese rice
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap