Conserved Protein Domain Family
bZIP_1

?
pfam00170: bZIP_1 
bZIP transcription factor
The Pfam entry includes the basic region and the leucine zipper region.
Statistics
?
Aligned: 15 rows
Threshold Bit Score: 67.3989
Threshold Setting Gi: 47117841
Created: 19-Apr-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P42774 220 ERELKRQKRKQSNRESARRSRLRKQAECEQLQQRVESLSNENQSLRDELQRLSSECDKLKSENN 283 thale cress
P42775 247 EKEVKREKRKQSNRESARRSRLRKQAETEQLSVKVDALVAENMSLRSKLGQLNNESEKLRLENE 310 thale cress
P42777 185 KAAAQRQKRMIKNRESAARSRERKQAYQVELETLAAKLEEENEQLLKEIEESTKERYKKLMEVL 248 thale cress
P18848 276 EKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIE 339 human
P39970 382 AKAWKRARLLERNRIAASKCRQRKKMSQLQLQREFDQISKENTMMKKKIENYEKLVQKMKKISR 445 Saccharomyces cerevisiae S288C
P29747 439 EKSLKKIRRKIKNKISAQESRRKKKEYMDQLERRVEILVTENHDYKKRLEGLEETNANLLSQLH 502 fruit fly
P17275 266 QERIKVERKRLRNRLAATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQVAQLKQKVM 329 human
P18289 210 QEKIKLERKRQRNRVAASKCRKRKLERISKLEDRVKVLKGENVDLASIVKNLKDHVAQLKQQVM 273 fruit fly
Q03060 284 EATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICS----PKT 343 human
P18846 211 DPQLKREIRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKTLKDLYS----NKS 270 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap