1VPE,1PHP


Conserved Protein Domain Family
PGK

?
pfam00162: PGK 
Click on image for an interactive view with Cn3D
Phosphoglycerate kinase
Statistics
?
Aligned: 915 rows
Threshold Bit Score: 218.766
Threshold Setting Gi: 283438133
Created: 3-Jun-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1VPE_A          12 GKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAK-VILLSHLGRP-Kg-ePsPEFSLAPVAKRLSELLg---- 84  Thermotoga ma...
Q1LSJ6          13 NKRVLIRADLNVPIKDGQITSYARINASLPTIITVLKQGAAsVMVTSHLGRPtEgqyD-ENLSLYRVVNYLQQKIs---- 87  Baumannia cic...
Q057F9          10 NKRVFIRLDLNVPIYKKKIISTERIDRSIPTILLALKKNAK-IILASHLGRPkEgiyN-KNFSLFPVFEYLKKKLpk--- 84  Buchnera aphi...
icbbe:BCTU_293  11 NKRILIRMDLNVPIQNKIITSTERIDKSIPTIKLALKKNAK-IIIASHLGRPkNytyE-KKLSLYPVYLYLKKIFpq--- 85  Buchnera aphi...
P59461          13 NKKVLIRSDLNVPIKNNKISSYARIHASLPTIKFALKNLAK-VIVTSHLGRPtEgiyK-KKFSLFPVFKYFKKILpe--- 87  Buchnera aphi...
P57525          13 EKRILIRSDLNVPIENGIIQSDARILAALPTIELALQKKAK-VIIMSHLGRPkEgyyT-KKYSLFPIFEYFKKKFnn--- 87  Buchnera aphi...
Q8D2P9          13 DKKVLIRSDLNVPIKNGKIMCNMRIIKSLETINFVIKNEAKcVIVASHLGNPiEekyD-YNFSLTHIVNHMKKIIk---- 87  Wigglesworthi...
Q7VRG3          13 NKRILIRADLNVPIRNGIITSARRIHASLPTIQLALSRSNQ-VMVTSHLGRPvEgeyD-SQFSLQPVVDYFQKNLsak-i 89  Candidatus Bl...
icbbe:SCc_185   13 GKRVLIRADLNVPIKDGKVISDARIRASLPTIRYALKQGAR-VIVTSHLGRPiEgeyN-EVFSLLPVVLCLKEYLg---- 86  Serratia symb...
ACQ68159         8 GQRLLIRSDLNVPLKNGEVISDARIRASLPTITAALKQGAK-VMVASHLGRPtEgqyD-AAFSLLPVVNYLKNHLysecp 85  Candidatus Ha...
1VPE_A          85 kEVKFVpA-VVGDevkkaveELKEGEVLLLENTRFHPGETKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFI- 162 Thermotoga ma...
Q1LSJ6          88 iPVRLI-KdYLNGi-----sFTE-KQLLVLENVRFNKGETKNDETLAKQYAALCDIFIMDAFGTAHRAHASTYGIAKYAp 160 Baumannia cic...
Q057F9          85 iNINFS-KdYLNGi-----nMKN-NHITVLENVRFNRGETKNDINLSKKYANLCDIFVMDAFATAHRIESSTYGICNFVk 157 Buchnera aphi...
icbbe:BCTU_293  86 iNITFI-KnYLNGf-----nIKS-GTIVLLENVRFNKGEKENCIELSKKYAKLCDIFVMDAFATAHRIESSTYGVCNFVd 158 Buchnera aphi...
P59461          88 tNIYFS-QnLTECs-----sIKS-GELIILENVRFNQGEKENSKILSKKYATLCDIFVMDAFGAIHRNEASTNGIIKYAk 160 Buchnera aphi...
P57525          88 tKIYFS-NnFLDGi-----kLNP-GEIALLENTRFNKGELNNDEQLSKKYSDLCDIFVMDAFGSAHRMQSSTYGIGKFVk 160 Buchnera aphi...
Q8D2P9          88 yPIRLI-QnYLNGfe------aKEKEIIVLENVRFNPGERKNDKNLSKKYANLCDILVMDSFGSSHRSESSTTGIIKFAp 160 Wigglesworthi...
Q7VRG3          90 gGVRLV-KdYLDGi-----nWIS-NELLILENVRFNKGEKTDDEVLAKKYASLCDVFVMDAFGSAHRIQSSTHNVSKFVk 162 Candidatus Bl...
icbbe:SCc_185   87 vPICLV-KdYLDGi-----dTVE-NKLIVLENVRFNKGEEKDDELLSKKYAKLCDVYVMDAFGAAHRTHASTHGVSKFAp 159 Serratia symb...
ACQ68159        86 fPIRFV-KdYLHGi-----dVVP-GELVVLENVRFNKGELKNDVQLSQQYAALCDVYVMDAFGTAHRAQASTEGVGQYAp 158 Candidatus Ha...
1VPE_A         163 PsVAGFLMEKEIKFLSKVTYNPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEEDKI 242 Thermotoga ma...
Q1LSJ6         161 LvCAGLLLYNELEVLSKALNQPVRPMVAIVGGSKVSTKLMLLNKLSKISDHLIVGGGIANTFLAAQGYNVGQSLLEPNLI 240 Baumannia cic...
Q057F9         158 KsCIGPLLYSEVKILKKILYNPLRPMVTIVGGAKVSTKFSLLKSLLKITDYLLVGGGIANTFI-STFYPVGKSLYEKNFQ 236 Buchnera aphi...
icbbe:BCTU_293 159 IaCAGPLLSLEIKNLKKILKKPKRPMISIIGGAKVSTKFNLLESLLKITDLMIVGGGIANTFI-SAYHSIGNSLHEKNFK 237 Buchnera aphi...
P59461         161 LaCSGLLLESELKTLNSALTNPVRPMVAIVGGAKVSTKFKTLTTLAKISDTLIVGGGIANTFI-SIDHNIGKSLHDPKFI 239 Buchnera aphi...
P57525         161 IaCAGLLLISEIDALKKALKKPKRPMVAIVGGSKVSTKFNVLNKLSKIADTIIVGGGIANTFL-AIDYKIGKSLYEPDFV 239 Buchnera aphi...
Q8D2P9         161 IsCIGLLFLKEIKYLKKALFNSKRPIVTIFGGSKISTKLGVIEKLSNISENVLVGGGIANTILFSKGHNIGKSLHDKNNI 240 Wigglesworthi...
Q7VRG3         163 VaCSGLLLEQEIAALHKALSNPVRPMVAIVGGSKVSSKLMVLESLSKVVDYLIVGGGIANTFLAAQGQNVGKSLYEAELI 242 Candidatus Bl...
icbbe:SCc_185  160 LsCAGLLLCSELEALSKALQNPARPMVAIVGGSKLSTKITLLDSLSKIADQVIVGGGIANTFIAAKGHNIGQSLYEPSFI 239 Serratia symb...
ACQ68159       159 IsCAGPLLSNELQALNQALSHPARPMVAVVGGSKVSTKLTALEALSKVADQLIVGGGISNTFLAALGHNIGQSLHEADLI 238 Candidatus Ha...
1VPE_A         243 DLAKELVEKAKekgVEIVLPVDAVIAQKiE-PGVe-kKVVRIDDgIPEGWMGLDIGPETIELFKQKLSDAKTVVWNGPMG 320 Thermotoga ma...
Q1LSJ6         241 NKAKQLLKYKN-----ILLPTDVRVSQE-L---DnaaTLKHIRE-VGNNEKIFDIGDESANRFAKILQQAKTILWNGPVG 310 Baumannia cic...
Q057F9         237 KKAINLYKTKK-----VFIPIDSRVSSK-Y-SIKseaIIRPTSK-ILPNQQILDIGDKTIKKFQEIIKKSKTILWNGPMG 308 Buchnera aphi...
icbbe:BCTU_293 238 IQAKKLYASKK-----IILPIDSRVGKS-Y-SITepsINKLISE-ISENEEIMDIGDQSIKNYIKLIKNARTILWNGPLG 309 Buchnera aphi...
P59461         240 EQAKILKEKYN-----IFIPTDSRVSTT-F-TYDsiaTIKSTSD-IHANEEIMDFGDISIKNMINIIKKAKTILWNGPIG 311 Buchnera aphi...
P57525         240 FEAKKLRDKYN-----IIVPIDSRVGKN-F-CKNeqaIIKSPDN-IKEDEEIMDFGDESIKKIISIITQSQTIMWNGPVG 311 Buchnera aphi...
Q8D2P9         241 SKIKKFLYK-----KNIIIPKDFIVTD--NiNKFssyKEKSIKE-IKNEDYIVDIGKKSCECFIKIIKKAKTIFWNGPLG 312 Wigglesworthi...
Q7VRG3         243 STAKSLLKDCN-----IPIPTDVRVSSE-F-SETaqsIMKNVTE-IKDDEQILDLGDNSIINILNILNNAKTILWNGPVG 314 Candidatus Bl...
icbbe:SCc_185  240 KKAQELLKTYD-----IPVPTDVRITTK-F-SDTaiaVMKNINE-INDDEQILDIGDVSANHLAMILKKAKTILWNGPVG 311 Serratia symb...
ACQ68159       239 PEAKKLLETCD-----IPIPTDVRVATE-F-SETaqaTLKPVDQ-VNSDEKILDIGDVSATHLVRILKNAKTILWNGPVG 310 Candidatus Ha...
1VPE_A         321 VFEIDDFAEGTKQVALAIAAlTeKgAITVVGGGDSAAAVNKFGLEDKFSHVSTGGGASLEFLEGK 385 Thermotoga maritima
Q1LSJ6         311 AFELTHFRQGTKILANAIVS-S-N-AFSIAGGGDTLAAIDYFNLNDKISYLSTGGGAFLSFIEGK 372 Baumannia cicadellinicola st...
Q057F9         309 VFEFPNFRIGTEKISKTIAN-S-N-CFSVAGGGDTIAVIDLFNLKKKISYISTGGGSFLKFIEEK 370 Buchnera aphidicola BCc
icbbe:BCTU_293 310 VFEFPNFRRGTEKISKAIAE-S-T-AFSVAGGGDTIAVIDLFQLKNKISYISTGGGAFLQFIENK 371 Buchnera aphidicola (Cinara ...
P59461         312 VFEFKNFSKGTEQLSKAIAS-S-D-AFSIAGGGDTLSVVEMFKVQNNISYLSTGGGSFLKFLEGn 373 Buchnera aphidicola str. Bp ...
P57525         312 VFEFPNFRKGTEMIAKTIAN-S-N-AFSIAGGGDTLSVIDMFNIKNNISYISTGGGAFLEFIEGK 373 Buchnera aphidicola str. APS...
Q8D2P9         313 LIEIKQFRNGTKEIANSVIH-S-S-AKSIIGGGETVLAMRMFNFIDRFSYISTGGGAFLSFIEKq 374 Wigglesworthia glossinidia e...
Q7VRG3         315 VFEFPNFRKGTEMVSNAIAN-S-N-AFSIAGGGDTLMAIDLFGIANQISYVSTGGGAFLEFIEGK 376 Candidatus Blochmannia flori...
icbbe:SCc_185  312 VFEFHNFRKGTEIVASAIAS-S-T-AFSIAGGGDTLAVIDLLGITNKISYISTGGGAFLKFVEGK 373 Serratia symbiotica str. 'Ci...
ACQ68159       311 VFEFPNFRKGTETLARAIAD-S-E-AFSIAGGGDTLAAIDLFSIADRISYISTGGGAFLEFVEGK 372 Candidatus Hamiltonella defe...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap