5EXP,1OJL,4BS1,3DZD,2VII


Conserved Protein Domain Family
Sigma54_activat

?
pfam00158: Sigma54_activat 
Click on image for an interactive view with Cn3D
Sigma-54 interaction domain
Statistics
?
PSSM-Id: 333886
View PSSM: pfam00158
Aligned: 243 rows
Threshold Bit Score: 183.366
Threshold Setting Gi: 81849823
Created: 14-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5EXP_A  12 LVGTSRAIQQVRQMMQQVADTD---ASVLILGESGTGKEVVARNLHY-----HSKRR--EGPFVPVNCGAI--PAE---L 76   Pseudomonas aerugino...
Q8R5U8 130 IIGSEGSLKAQISLAKAAVLYPphgLHTLIVGPPGAGKSQLAEAMYNfavesGRFRE--GAPFVVFNCADY--ADNp-qL 204  Caldanaerobacter sub...
Q8R5T3 117 IIGYNGSLKEQIEQAKAAVVYPpngLHTLIIGPPGSGKTYLAESMYK-----FGRRKglKGSFEVLNCADYyhNPQ---L 188  Caldanaerobacter sub...
Q8R5U5  90 IIGAELSLKNAVQQAKAAIIYPphgLHTLLLGETGTGKSMFAEVMYNfakeiGRIKK--NAPFVTFNCADYasNPQ---L 164  Caldanaerobacter sub...
Q8Y6G6  82 LIGSEDSLKVSIQQAKAAILYPpngLHSLILGRTGTGKSLFAECMYQfakesETIPA--DAPFVSFNCADYaqNPQ---L 156  Listeria monocytogenes
Q97M18  77 FVKNNLSLRQAVEQLKAAILYPpngMNCLILGNTGVGKSMFASLMHEyavemRVKEK--GSPFITFNCADY--SNNp-qL 151  Clostridium acetobut...
Q815F4  16 IE--NTSLKIAIEKAKASILYPpngMHTLLLGETGVGKSMFASLMHEyaievEQLPK--DAPFIVFNCADY--ANNpqlL 89   Bacillus cereus ATCC...
Q839Y1 122 IIGSAGSMKTPVEQAKAAILYPpkgLNCLITGPTGSGKTYFAHAMFQfaklnQIVAK--EKEFVVFNCADYahNPE---L 196  Enterococcus faecalis
Q82ZR7 117 VIGFDGSLADAIKKLKAAILYPpngLNILLTGESGVGKTLIAEQLHQfy--qVKMNQ--EVPFIYFNCAEYfnNPE---L 189  Enterococcus faecalis
P23914 114 MIGAKGSLKKAISQAKAAVFYPpngLHMLLLGPTGSGKSLFANRIYQfaiysDILKA--GAPFITFNCADYynNPQ---L 188  Bacillus subtilis su...
5EXP_A  77 LESELFGHEKGAFTGAITSRAGRFELANGGTLFLDEIGDMPLPMQVKLLRVLQERTFERVG-SN-K-TQNVDVRIIAATH 153  Pseudomonas aerugino...
Q8R5U8 205 LMAQLFGYVKGAFTGADTEKRGLVEKANGGILFLDEVHRLPSEGQEILFYLLDKGKFRRLG-ET-EnTREAQIMLIAATT 282  Caldanaerobacter sub...
Q8R5T3 189 LLSHLFGHAKGAYTGAFVERIGLVEKANNGILFLDEVHRLPPEGQEMLFYLIDKGMYKRLG-DT-E-ERKVNVMIIAATT 265  Caldanaerobacter sub...
Q8R5U5 165 LMAHLFGVKKGAYTGADSDKVGLVEKADGGILFLDEVHRLPPEGQEMLFYLIDKGLYRRLGeSD-V-EHKANVLIICATT 242  Caldanaerobacter sub...
Q8Y6G6 157 LFGHIFGVIKGAYTGAEETREGLLKKADGGILFLDEIHRLPPEGQEMLFTFIDKGEFRPLG-ES-AnVHHAQVQIIGATT 234  Listeria monocytogenes
Q97M18 152 LTSQLFGIKKGTYTGADSDRIGLIEKANGGILFLDEVHRLPPEGQEALFTFLDKGIFRRMG-DD-K-SRSSNVLIISATT 228  Clostridium acetobut...
Q815F4  90 LGQ-LFGIKKGAYTGASDQK-GLIEKAHEGILFLDEVHRLPPEGQEMLFTFIDRGVYRRLG-ET-EnERKAQVLIITATT 165  Bacillus cereus ATCC...
Q839Y1 197 LMSHLFGYVEGAFTGATKAKEGIIDEADGSILFLDEVHRLPPEGQEMIFYFMDHGVYARLG-ETvK-SHHADVRIICATT 274  Enterococcus faecalis
Q82ZR7 190 LTSHLFGYKKGSFTGAVNDQKGLVELADGGFLFLDEVHRLTSEGQEKLFTVLDKGYFTRMGeAE-K-QRNVSIKFIFATT 267  Enterococcus faecalis
P23914 189 LLSQLFGHKKGSFTGAAEDKAGLVEQANGGILFMDEIHRLPPEGQEMLFYFIDSGSYNRLGeSE-H-KRTSNVLFICATT 266  Bacillus subtilis su...
5EXP_A 154 KNLEKMIEDGTFREdlyyrlNVFPIE 179  Pseudomonas aeruginosa PAO1
Q8R5U8 283 ENPESALLL-TFRRr----iPVL-IE 302  Caldanaerobacter subterraneus subsp. tengcongensis
Q8R5T3 266 EK-IDSILLRTFIRr----iPVI-IQ 285  Caldanaerobacter subterraneus subsp. tengcongensis
Q8R5U5 243 EDIESALLKTFIRr-----iPMV-IK 262  Caldanaerobacter subterraneus subsp. tengcongensis
Q8Y6G6 235 ESPDNFLLE-TFTRr-----iPMTIT 254  Listeria monocytogenes
Q97M18 229 ENPNSSLLK-TFTRr----iPML-IT 248  Clostridium acetobutylicum
Q815F4 166 EEPNSFLLK-TFTRr-----iPMTVT 185  Bacillus cereus ATCC 14579
Q839Y1 275 ENPTSSLLNTFVRr-----iPII-IQ 294  Enterococcus faecalis
Q82ZR7 268 ----EAVNQ-HFLKtflrriPV-TLA 287  Enterococcus faecalis
P23914 267 ENPSSALLKTFLRR------IPMTIH 286  Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap