1XP8


Conserved Protein Domain Family
RecA

?
pfam00154: RecA 
Click on image for an interactive view with Cn3D
recA bacterial DNA recombination protein
RecA is a DNA-dependent ATPase and functions in DNA repair systems. RecA protein catalyzes an ATP-dependent DNA strand-exchange reaction that is the central step in the repair of dsDNA breaks by homologous recombination.
Statistics
?
Aligned: 16 rows
Threshold Bit Score: 457.238
Threshold Setting Gi: 60392995
Created: 13-Mar-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1XP8_A  23 KAIETAMSQIEKAFGKGSIMKLgAESk-LDVQVVSTGSLSLDLALGVGGIPRGRITEIYGPESGGKTTLALAIVAQAQKA 101 Deinococcus radiodurans
P42443  20 KAIETAMSQIEKAFGKGSIMKLgAESk-LDVQVVSTGSLSLDLALGVGGIPRGRITEIYGPESGGKTTLALAIVAQAQKA 98  Deinococcus radiodura...
P42442  20 KALDAALALIEKDFGKGAVMRLgDENr-PPIQTISSGNTAIDIALGIGGFPRGRIVEVYGPESSGKTTVALHAIAQAQKA 98  Corynebacterium gluta...
P14582  12 KALNLVLNQIERNFGKGAIMRLgDAAq-MKVATIPSGALTLDQAMG-GGFPRGRIVEIYGPESSGKTTVALHAIAEVQKA 89  Synechococcus sp. PCC...
O67905  10 KALEVALSNIEKRFGKGAVMPL-KSVekVQVETIPTGSLALDIATGVGGIPKGRITEIFGVESSGKTTLALHVIAEAQKR 88  Aquifex aeolicus VF5
P29226  15 KIIKSTIEEIEKKFGNESIMLL-GQKekCDVDVFSSGSYAINSALGIGGFPKGRIIEIFGPESSGKTTIALHTIAEIQKK 93  Mycoplasma pulmonis U...
A9NGM3   8 QALELALKQIEKQFGKGSIMKLgDGAd-HSIEAIPSGSIALDIALGIGGYPRGRIIEVYGPESSGKTTLTLHAMASAQKQ 86  Acholeplasma laidlawi...
P16971   6 AALDMALKQIEKQFGKGSIMKLgEKTd-TRISTVPSGSLALDTALGIGGYPRGRIIEVYGPESSGKTTVALHAIAEVQQQ 84  Bacillus subtilis sub...
P42445   9 KAISLAIKQIDKVFGKGALVRLgDKQv-EKIDSISTGSLGLDLALGIGGVPKGRIIEIYGPESSGKTTLSLHIIAECQKN 87  Helicobacter pylori 2...
B7J7A9   7 KALSAALSQIDKQFGKGAVMRLgDHNaiKDIEVYSTGSLGLDLALGVGGLPRGRVVEIYGPESSGKTTLTLHAIASCQAA 86  Acidithiobacillus fer...
1XP8_A 102 GGTCAFIDAEHALDPVYARALGVNTDELLVSQPDNGEQALEIMELLVRSGAIDVVVVDSVAALTPRAEIEGDMGDSLPGL 181 Deinococcus radiodurans
P42443  99 GGTCAFIDAEHALDPVYARALGVNTDELLVSQPDNGEQALEIMELLVRSGAIDVVVVDSVAALTPRAEIEGDMGDSLPGL 178 Deinococcus radiodura...
P42442  99 GGIAAFIDAEHALDPDYARKLGVDTDALLVSQPDTGEQALEIADMLVRSGAIDIIVIDSVAALTPKAEIEGEMGDSHVGL 178 Corynebacterium gluta...
P14582  90 GGVAAFIDAEHALDPTYSAALGVDIENLLVAQPDNGESALEIADQLVRSAAVDLIVIDSVAALVPRAEIEGEMGDVQVGL 169 Synechococcus sp. PCC...
O67905  89 GGVAVFIDAEHALDPKYAKKLGVDVENLYISQPDYGEQALEIAESLINSGAVDVIVVDSVAALVPKDELEGEMGEAQVGK 168 Aquifex aeolicus VF5
P29226  94 NGFAAFIDVEHSIDPVYAKNLGIDIDNLLISQPDSGEQALEIVDILAKSGSIDLIVVDSVAALVPEAELNGEMKDQSIGL 173 Mycoplasma pulmonis U...
A9NGM3  87 GGTVAFIDAEHALDPNYAKALGVDIDNLVLSQPDTGEQALDIAEALIKSGSIDMIVIDSVAALVPEAEIAGDMSANHVGL 166 Acholeplasma laidlawi...
P16971  85 GGQAAFIDAEHALDPVYAQKLGVNIEELLLSQPDTGEQALEIAEALVRSGAVDIVVVDSVAALVPKAEIEGDMGDSHVGL 164 Bacillus subtilis sub...
P42445  88 GGVCAFIDAEHALDVHYAKRLGVDTENLLVSQPDTGEQALEILETITRSGGIDLVVVDSVAALTPKAEIDGDMGDQHVGL 167 Helicobacter pylori 2...
B7J7A9  87 GGTAAFIDAEHALDPGYAHKLGVDLENLLISQPDTGEQALEIADMLVRSGAVDLIVIDSVAALTPKAEIEGDMGDSHVGL 166 Acidithiobacillus fer...
1XP8_A 182 QARLMSQALRKLTAILSKTGTAAIFINQVREKIGVMYG-NPETTTGGRALKFYASVRLDVRKIGQPTKvGN-DAVANTVK 259 Deinococcus radiodurans
P42443 179 QARLMSQALRKLTAILSKTGTAAIFINQVREKIGVMYG-NPETTTGGRALKFYASVRLDVRKIGQPTK-VGnDAVANTVK 256 Deinococcus radiodura...
P42442 179 QARLMSQALRKMTGALYNSGTTAIFINQLREKIGVMFG-SPETTTGGKALKFYASVRCDIRRIQTLKD-GQ-DAIGNRTR 255 Corynebacterium gluta...
P14582 170 QARLMSKALRKIAGNMGRSGCTVIFLNQLRQKIGISYG-NPEVTTGGTALKFYASVRLDIRRIQTLKK-GSeGEFGIRAK 247 Synechococcus sp. PCC...
O67905 169 QARLMSQALRKLKGAVHKSNTALIFINQIREKIGVMFG-NPETTPGGRALKFFSDMRLEVRRLGDVKE-GG-EKKGYRVK 245 Aquifex aeolicus VF5
P29226 174 QARLMSKALRKITGSLSKNKTSVIFINQVREKIGVVFG-NPETTPGGRALKFYASIRLDVRKSTNIML-NNdi-sGNQIR 250 Mycoplasma pulmonis U...
A9NGM3 167 QARMMSQAMRKMSGVISKSNVVAIFINQIREKVGVMFG-NPETTPGGRALKFFSSVRLEIRRAEAIKQ-GS-EMIGIKSN 243 Acholeplasma laidlawi...
P16971 165 QARLMSQALRKLSGAINKSKTIAIFINQIREKVGVMFG-NPETTPGGRALKFYSSVRLEVRRAEQLKQ-GN-DVMGNKTK 241 Bacillus subtilis sub...
P42445 168 QARLMSHALRKITGVLHKMNTTLIFINQIRMKIGMMGYgSPETTTGGNALKFYASVRIDIRRIASLKQ-NE-QHIGNRAK 245 Helicobacter pylori 2...
B7J7A9 167 QARLMSQALRKLTANISRTNTLVIFINQIRMKIGVMYG-SPETTTGGNALKFYASVRLDIRRIGAIKK-SD-EVVGNDTR 243 Acidithiobacillus fer...
1XP8_A 260 IKTVKNKVAAPFKEVELALVYGKGFD 285 Deinococcus radiodurans
P42443 257 IKTVKNKVAAPFKEVELALVYGKGFD 282 Deinococcus radiodurans R1
P42442 256 LKVVKNKVSPPFKIAEFDIMYGEGIS 281 Corynebacterium glutamicum ATCC 13032
P14582 248 VKVAKNKVAPPFRIAEFDIIFGKGIS 273 Synechococcus sp. PCC 7002
O67905 246 VRVVKNKLAPPFQEAEFDIIYGEGIc 271 Aquifex aeolicus VF5
P29226 251 VKVVKNKLAPPFKIAETEIIFSKGIN 276 Mycoplasma pulmonis UAB CTIP
A9NGM3 244 VKVVKSKVAPPLKTASIDIMYGTGIS 269 Acholeplasma laidlawii PG-8A
P16971 242 IKVVKNKVAPPFRTAEVDIMYGEGIS 267 Bacillus subtilis subsp. subtilis str. 168
P42445 246 AKVVKNKVAPPFREAEFDIMFGEGIS 271 Helicobacter pylori 26695
B7J7A9 244 VKVVKNKVAPPFREAEFAIYYGEGIS 269 Acidithiobacillus ferrooxidans ATCC 23270
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap