
Conserved Protein Domain Family

pfam00152: tRNA-synt_2 
Click on image for an interactive view with Cn3D
tRNA synthetases class II (D, K and N)
PSSM-Id: 365908
View PSSM: pfam00152
Aligned: 93 rows
Threshold Bit Score: 163.504
Threshold Setting Gi: 405969068
Created: 19-Apr-2019
Updated: 18-Jul-2019
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
1N9W_A   234 EEALLAEMLEEA-LNTagdeirl---------------lgatwpSFPQD-IP--RLTHAEAKRIlkeel----------- 283 Thermus thermophilu...
Q8ZUX9   157 AEDLITYVVKYVkDVHgkeleav---------------lgrqlyEFKRP-FK--RYSHKEAVEFvnk------------- 205 Pyrobaculum aerophilum
Q7NBK8   173 IKFIVNELIKKHknlidffntnnsnrlkkwlsnevidlkhdhviS-----LL--KLEYPVGIEKiylnk----------- 234 Mycoplasma gallisep...
Q6C700   266 AEGMVKSCLAPLmEEGnkarndlldarr----saeqkeelldrwDMANCdFP--RLTYKQAIKIlnlqhlkep------- 332 Yarrowia lipolytica
Q8BGV0   276 MEELFKATTEMVlSHCpedvelchqf--------iaagqkgrleHMLKNnFL--IISYTEAIEIlkqasqnf-------- 337 house mouse
Q8U4D3   243 EEELVSYMVQRTlELRkkeiemf--------------rddlttlKNTEPpFP--RISYDEAIDIlqskgi---------- 296 Pyrococcus furiosus...
Q8SQK8   253 IEALVSYSMRRFyEEMksdilsv--------------fpefefhKVPRTpFK--RIKYSEAIELlkskgykke------- 309 Encephalitozoon cun...
O26328   251 LENLVVRVIEDVnEHCtdalet-----------------lgrtlEVPETpFE--RLEYDEAVEMvnskgv---------- 301 Methanothermobacter...
Q980V3   242 IEQIIYNMINDVkRECenelk-------------------ilnyTPPNVrIPikKVSYSDAIELlkskgv---------- 292 Saccharolobus solfa...
EKC34078 228 MEGLVKSLTREVmETSaddirfvhrrn------sassdlltaidDMINKeFI--RLPYVEALNIvnkicespelkvmlte 299 Pacific oyster
1N9W_A       -------------------------------------------------------------------------------- Thermus thermophilu...
Q8ZUX9       -------------------------------------------------------------------------------- Pyrobaculum aerophilum
Q7NBK8       -------------------------------------------------------------------------------- Mycoplasma gallisep...
Q6C700       -------------------------------------------------------------------------------- Yarrowia lipolytica
Q8BGV0       -------------------------------------------------------------------------------- house mouse
Q8U4D3       -------------------------------------------------------------------------------- Pyrococcus furiosus...
Q8SQK8       -------------------------------------------------------------------------------- Encephalitozoon cun...
O26328       -------------------------------------------------------------------------------- Methanothermobacter...
Q980V3       -------------------------------------------------------------------------------- Saccharolobus solfa...
EKC34078 300 knpyiwdpasdslttpmvsltlrddldqklnvtsltnpvdvyisnfnpviqkseenftlsvqdfdsfnatqttelcrimt 379 Pacific oyster
1N9W_A       -------------------------------------------------------------------------------- Thermus thermophilu...
Q8ZUX9       -------------------------------------------------------------------------------- Pyrobaculum aerophilum
Q7NBK8       -------------------------------------------------------------------------------- Mycoplasma gallisep...
Q6C700       -------------------------------------------------------------------------------- Yarrowia lipolytica
Q8BGV0       -------------------------------------------------------------------------------- house mouse
Q8U4D3       -------------------------------------------------------------------------------- Pyrococcus furiosus...
Q8SQK8       -------------------------------------------------------------------------------- Encephalitozoon cun...
O26328       -------------------------------------------------------------------------------- Methanothermobacter...
Q980V3       -------------------------------------------------------------------------------- Saccharolobus solfa...
EKC34078 380 fnstegrstvftvrpltfnltvnvievqnrtnmshlnvraagvslsklnnfthifssfptgevslafcidqtvenylels 459 Pacific oyster
1N9W_A       -------------------------------------------------------------------------------- Thermus thermophilu...
Q8ZUX9       -------------------------------------------------------------------------------- Pyrobaculum aerophilum
Q7NBK8       -------------------------------------------------------------------------------- Mycoplasma gallisep...
Q6C700       -------------------------------------------------------------------------------- Yarrowia lipolytica
Q8BGV0       -------------------------------------------------------------------------------- house mouse
Q8U4D3       -------------------------------------------------------------------------------- Pyrococcus furiosus...
Q8SQK8       -------------------------------------------------------------------------------- Encephalitozoon cun...
O26328       -------------------------------------------------------------------------------- Methanothermobacter...
Q980V3       -------------------------------------------------------------------------------- Saccharolobus solfa...
EKC34078 460 rqcltltscgltletqlyfavcmywnvtedkwsssgcqvgqqttpasmhcqcthltafsgsflvapnfvdpfadaalflt 539 Pacific oyster
1N9W_A       -------------------------------------------------------------------------------- Thermus thermophilu...
Q8ZUX9       -------------------------------------------------------------------------------- Pyrobaculum aerophilum
Q7NBK8       -------------------------------------------------------------------------------- Mycoplasma gallisep...
Q6C700       -------------------------------------------------------------------------------- Yarrowia lipolytica
Q8BGV0       -------------------------------------------------------------------------------- house mouse
Q8U4D3       -------------------------------------------------------------------------------- Pyrococcus furiosus...
Q8SQK8       -------------------------------------------------------------------------------- Encephalitozoon cun...
O26328       -------------------------------------------------------------------------------- Methanothermobacter...
Q980V3       -------------------------------------------------------------------------------- Saccharolobus solfa...
EKC34078 540 ffsnpvvvscviliwliyftlltwakkqdrldkvwdvenlinlrtqyrggviiahennpdhkyaylvcvitgwwknagtt 619 Pacific oyster
1N9W_A   284 ------------------------------------------------------------------gypvgQDLSEEAER 297 Thermus thermophilu...
Q8ZUX9   206 --------------------------------------------------------------------lgcENSPREELR 217 Pyrobaculum aerophilum
Q7NBK8   235 -------------------------------------------------------------------ndfiESVNSKGEQ 247 Mycoplasma gallisep...
Q6C700   333 ---------------------------------------------------------------fahrpdyeVGLRSEHEK 349 Yarrowia lipolytica
Q8BGV0   338 ----------------------------------------------------------------aftpkwgVDLQTEHEK 353 house mouse
Q8U4D3   297 ------------------------------------------------------------------nvqwgDDLGADEER 310 Pyrococcus furiosus...
Q8SQK8   310 ---------------------------------------------------------------dntdfelgDDIPDAAER 326 Encephalitozoon cun...
O26328   302 ------------------------------------------------------------------pmkhgEDLPRAAEK 315 Methanothermobacter...
Q980V3   293 ------------------------------------------------------------------nikfgDDIGTPELR 306 Saccharolobus solfa...
EKC34078 620 ssvslsfagteghsgrhclsesvpgrqcflsgyedwflvttshslgdlrslsvwhdssgksphwsvscewgDDLQRAHEK 699 Pacific oyster
O26328   388 FESYLSAFEY-GMPPHAGWGLGAERFNMTLTGLKNIRETVLFPRDR 432 Methanothermobacter thermautotrophicus str. Delta H
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap