1N9W,1X54


Conserved Protein Domain Family
tRNA-synt_2

?
pfam00152: tRNA-synt_2 
Click on image for an interactive view with Cn3D
tRNA synthetases class II (D, K and N)
Statistics
?
PSSM-Id: 333881
View PSSM: pfam00152
Aligned: 92 rows
Threshold Bit Score: 163.121
Threshold Setting Gi: 405969068
Created: 13-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1N9W_A   104 NPDTLLEYRYVTL-RGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVRAg-----AEGGSGLFGV----------- 166 Thermus thermophilu...
Q8ZUX9    23 MLEEWLKYSWRWA-VNEKYKLVFKVQASILRALREFLDSKGFVEVLSPIIGPVtd---pGIRGAKQASI----------- 87  Pyrobaculum aerophilum
Q7NBK8    31 yMYEDFRKNFIKTiKNERYSNLLKLFSVINKLTYIWMENNNVEIVNLPITTQSvtspmgLGSDSKPYKVisks------- 103 Mycoplasma gallisep...
Q6C700   128 KQEFLRTLPALRW-RTSVNSSTLRYRSFCMAQMTNFFAENDFVQTNPPLLTSSd-----CEGAGEVFKVaggg------- 194 Yarrowia lipolytica
Q8BGV0   135 PLEYLRQYPHLRC-RTNALGSILRVRSEATAAIHSYFKDNGFVHIHTPVLTSNd-----CEGAGELFQVepsski----k 204 house mouse
Q8U4D3   114 sPELLLDYRHLHI-RTPKASAIMKVKETLIMAAREWLLKDGWHEVFPPILVTGa-----VEGGATLFKL----------- 176 Pyrococcus furiosus...
Q8SQK8   124 SVNAILTNGHLGL-RTKKRQLFLKARGHLLKIIRDFYFEGEYTEVTPPTMVQTq-----VEGGSTLFKL----------- 186 Encephalitozoon cun...
O26328   121 EIDTRLDARFLDL-RKPSVSAIFKIKSRMLHSVRVFLEEQGFLEINTPKLVASa-----TEGGTELFPI----------- 183 Methanothermobacter...
Q980V3   113 DIDTRLRERLLDL-RRLEMQAVLKIQSVAVKSFRETLYKHGFVEVFTPKIIASa-----TEGGAQLFPV----------- 175 Sulfolobus solfatar...
EKC34078  83 SHEHLRQFLHLRP-KTALTSAVLRIRNTATMAVHKYFQENGYIFIHTPILSSNd-----CEGAGQLFTVkvsekndddek 156 Pacific oyster
1N9W_A   167 ----DYFek-raYLAQSPQLYKQI-MVGv-FERVYEVAPVWRMEEHH---TSRHLnEYLSLDVEM--GFIaDEED-LMRL 233 Thermus thermophilu...
Q8ZUX9    88 ----DFYga-eyKVMSSAILYKQYmARV--LGKIYFVSPNIRLEPPDsifTGRHLvEFYQLDLEM--YKA-TYHE-AMDL 156 Pyrobaculum aerophilum
Q7NBK8   104 nlnyEFY------LADSMQFHLELmLRAkdISSVGYITNTFRGEQVD----NRHLhQFNHFEIEMlgNLN-NCKEkIIDY 172 Mycoplasma gallisep...
Q6C700   195 -kgdKFFgdkpaYLTVSTQLHLEVlAAA--VGRVWTFTPAFRAENSD---TNRHLsEFWMAEAEI--SFI-DDLEpLMDL 265 Yarrowia lipolytica
Q8BGV0   205 gpkeSFFdv-paFLTVSGQLHLEVmSGA--FTQVFTFGPTFRAENSQ---SRRHLaEFYMVEAEI--SFV-ESLQdLMQV 275 house mouse
Q8U4D3   177 ----KYFdk-yaYLSQSAQLYLEAaIFG--LEKVWSLTPSFRAEKSR---TRRHLtEFWHLELEA--AWM-DLWD-IMKV 242 Pyrococcus furiosus...
Q8SQK8   187 ----DYYge-daYLTQSSQLYLETvVPA--SHRAYCIMPSYRAEKSR---TRRHLsEYTHVEAEM--ADI-DLDG-LISS 252 Encephalitozoon cun...
O26328   184 ----TYFer-eaFLGQSPQLYKQImMSTg-LDRVYEIAPIFRAEEHD---TLRHLnEVISIDIEA--SFV-DHED-VMKI 250 Methanothermobacter...
Q980V3   176 ----LYFgk-eaFLAQSPQLYKELlAGA--IERVFEIAPAWRAEESD---TPYHLsEFISMDVEM--AFA-DYND-IMAL 241 Sulfolobus solfatar...
EKC34078 157 klipEFFts-pvFLTVSGQLHLEAvASG--ISKVYTFSPAFRAERSQ---TSNHLaEFYMIEAEL--SFT-ECLEdIMQV 227 Pacific oyster
1N9W_A   234 EEALLAEMLEEA-LNTagdeirl---------------lgatwpSFPQD-IP--RLTHAEAKRIlkeel----------- 283 Thermus thermophilu...
Q8ZUX9   157 AEDLITYVVKYVkDVHgkeleav---------------lgrqlyEFKRP-FK--RYSHKEAVEFvnk------------- 205 Pyrobaculum aerophilum
Q7NBK8   173 IKFIVNELIKKHknlidffntnnsnrlkkwlsnevidlkhdhviS-----LL--KLEYPVGIEKiylnk----------- 234 Mycoplasma gallisep...
Q6C700   266 AEGMVKSCLAPLmEEGnkarndlldarr----saeqkeelldrwDMANCdFP--RLTYKQAIKIlnlqhlkep------- 332 Yarrowia lipolytica
Q8BGV0   276 MEELFKATTEMVlSHCpedvelchqf--------iaagqkgrleHMLKNnFL--IISYTEAIEIlkqasqnf-------- 337 house mouse
Q8U4D3   243 EEELVSYMVQRTlELRkkeiemf--------------rddlttlKNTEPpFP--RISYDEAIDIlqskgi---------- 296 Pyrococcus furiosus...
Q8SQK8   253 IEALVSYSMRRFyEEMksdilsv--------------fpefefhKVPRTpFK--RIKYSEAIELlkskgykke------- 309 Encephalitozoon cun...
O26328   251 LENLVVRVIEDVnEHCtdalet-----------------lgrtlEVPETpFE--RLEYDEAVEMvnskgv---------- 301 Methanothermobacter...
Q980V3   242 IEQIIYNMINDVkRECenelk-------------------ilnyTPPNVrIPikKVSYSDAIELlkskgv---------- 292 Sulfolobus solfatar...
EKC34078 228 MEGLVKSLTREVmETSaddirfvhrrn------sassdlltaidDMINKeFI--RLPYVEALNIvnkicespelkvmlte 299 Pacific oyster
1N9W_A       -------------------------------------------------------------------------------- Thermus thermophilu...
Q8ZUX9       -------------------------------------------------------------------------------- Pyrobaculum aerophilum
Q7NBK8       -------------------------------------------------------------------------------- Mycoplasma gallisep...
Q6C700       -------------------------------------------------------------------------------- Yarrowia lipolytica
Q8BGV0       -------------------------------------------------------------------------------- house mouse
Q8U4D3       -------------------------------------------------------------------------------- Pyrococcus furiosus...
Q8SQK8       -------------------------------------------------------------------------------- Encephalitozoon cun...
O26328       -------------------------------------------------------------------------------- Methanothermobacter...
Q980V3       -------------------------------------------------------------------------------- Sulfolobus solfatar...
EKC34078 300 knpyiwdpasdslttpmvsltlrddldqklnvtsltnpvdvyisnfnpviqkseenftlsvqdfdsfnatqttelcrimt 379 Pacific oyster
1N9W_A       -------------------------------------------------------------------------------- Thermus thermophilu...
Q8ZUX9       -------------------------------------------------------------------------------- Pyrobaculum aerophilum
Q7NBK8       -------------------------------------------------------------------------------- Mycoplasma gallisep...
Q6C700       -------------------------------------------------------------------------------- Yarrowia lipolytica
Q8BGV0       -------------------------------------------------------------------------------- house mouse
Q8U4D3       -------------------------------------------------------------------------------- Pyrococcus furiosus...
Q8SQK8       -------------------------------------------------------------------------------- Encephalitozoon cun...
O26328       -------------------------------------------------------------------------------- Methanothermobacter...
Q980V3       -------------------------------------------------------------------------------- Sulfolobus solfatar...
EKC34078 380 fnstegrstvftvrpltfnltvnvievqnrtnmshlnvraagvslsklnnfthifssfptgevslafcidqtvenylels 459 Pacific oyster
1N9W_A       -------------------------------------------------------------------------------- Thermus thermophilu...
Q8ZUX9       -------------------------------------------------------------------------------- Pyrobaculum aerophilum
Q7NBK8       -------------------------------------------------------------------------------- Mycoplasma gallisep...
Q6C700       -------------------------------------------------------------------------------- Yarrowia lipolytica
Q8BGV0       -------------------------------------------------------------------------------- house mouse
Q8U4D3       -------------------------------------------------------------------------------- Pyrococcus furiosus...
Q8SQK8       -------------------------------------------------------------------------------- Encephalitozoon cun...
O26328       -------------------------------------------------------------------------------- Methanothermobacter...
Q980V3       -------------------------------------------------------------------------------- Sulfolobus solfatar...
EKC34078 460 rqcltltscgltletqlyfavcmywnvtedkwsssgcqvgqqttpasmhcqcthltafsgsflvapnfvdpfadaalflt 539 Pacific oyster
1N9W_A       -------------------------------------------------------------------------------- Thermus thermophilu...
Q8ZUX9       -------------------------------------------------------------------------------- Pyrobaculum aerophilum
Q7NBK8       -------------------------------------------------------------------------------- Mycoplasma gallisep...
Q6C700       -------------------------------------------------------------------------------- Yarrowia lipolytica
Q8BGV0       -------------------------------------------------------------------------------- house mouse
Q8U4D3       -------------------------------------------------------------------------------- Pyrococcus furiosus...
Q8SQK8       -------------------------------------------------------------------------------- Encephalitozoon cun...
O26328       -------------------------------------------------------------------------------- Methanothermobacter...
Q980V3       -------------------------------------------------------------------------------- Sulfolobus solfatar...
EKC34078 540 ffsnpvvvscviliwliyftlltwakkqdrldkvwdvenlinlrtqyrggviiahennpdhkyaylvcvitgwwknagtt 619 Pacific oyster
1N9W_A   284 ------------------------------------------------------------------gypvgQDLSEEAER 297 Thermus thermophilu...
Q8ZUX9   206 --------------------------------------------------------------------lgcENSPREELR 217 Pyrobaculum aerophilum
Q7NBK8   235 -------------------------------------------------------------------ndfiESVNSKGEQ 247 Mycoplasma gallisep...
Q6C700   333 ---------------------------------------------------------------fahrpdyeVGLRSEHEK 349 Yarrowia lipolytica
Q8BGV0   338 ----------------------------------------------------------------aftpkwgVDLQTEHEK 353 house mouse
Q8U4D3   297 ------------------------------------------------------------------nvqwgDDLGADEER 310 Pyrococcus furiosus...
Q8SQK8   310 ---------------------------------------------------------------dntdfelgDDIPDAAER 326 Encephalitozoon cun...
O26328   302 ------------------------------------------------------------------pmkhgEDLPRAAEK 315 Methanothermobacter...
Q980V3   293 ------------------------------------------------------------------nikfgDDIGTPELR 306 Sulfolobus solfatar...
EKC34078 620 ssvslsfagteghsgrhclsesvpgrqcflsgyedwflvttshslgdlrslsvwhdssgksphwsvscewgDDLQRAHEK 699 Pacific oyster
1N9W_A   298 LLGEyakeRWGSDWLFVTRYPRSVRPFYTYPEED---GTTRSFDLLFR-GL-EITSGGQRIHRYEELLESLKAKGMDpea 372 Thermus thermophilu...
Q8ZUX9   218 WECEkvmsAHHDSPFFVYDYPRGSRGFYDREDPEr-pGVLRDFDMLYPeGFgEAISGAEREFEPERLVERIREGGEDpak 296 Pyrobaculum aerophilum
Q7NBK8   248 YLIN----KFKNNIIWLSNFPWQLVPFYQKIEGDy----AINSDLLI--GIgETVGSGQRCITYKETYDSILKHKNNpkh 317 Mycoplasma gallisep...
Q6C700   350 WLAT----EYFISPVFVTDYPKEQKPFYMKQSPHd-sQTVACFDLLMP-HIgEVIGGSVREDNYDTLLKNIETTGMDksa 423 Yarrowia lipolytica
Q8BGV0   354 YLVR----HCGNIPVFVINYPSELKPFYMRENEDgpqNTVAAVDLLVP-GVgELFGGSLREERYHVLEQRLARSGLTk-a 427 house mouse
Q8U4D3   311 VLTE-----EFDRPFFVYGYPKQIKAFYMKEDPNd-pRKVLAADMLAPeGYgEIIGGSQREDDYEKLLNRILEEGMDpkd 384 Pyrococcus furiosus...
Q8SQK8   327 YLVEv---VGDGCPVFLTHFLVGHKPFYMRKDENd-kGLTESTDLLFP-GIgEILGGSMRQDTYEDLIEGFRRENINidp 401 Encephalitozoon cun...
O26328   316 ALGE-----IMDGYYFITSWPTAIKPFYVMPDEDd-pERSHAFDLMYR-DL-EISSGAMRVHQHDLLVEKIKRQGLNpds 387 Methanothermobacter...
Q980V3   307 VLYN----ELKEDLYFVTDWPWLSRPFYTKQKKDn-pQLSESFDLIFR-WL-EIVSGSSRNHVKEVLENSLKVRGLNpes 379 Sulfolobus solfatar...
EKC34078 700 ALVK----HCGNVPVFVTDYPEELKPFYARLNEDh--KTVAGLDLLIP-GVgELCGGTLREERYDILHQKLKSKNLLn-t 771 Pacific oyster
1N9W_A   373 FHGYLEVFKY-GMPPHGGFAIGAERLTQKLLGLPNVRYARAFPRDR 417 Thermus thermophilus HB8
Q8ZUX9   297 YQWFLQMAKElYPLQTAGFGIGVERLTRYICGLRAVWEARPYPKVA 342 Pyrobaculum aerophilum
Q7NBK8   318 YDWYLKMKLE-SELETSGFGLGLERLVLFIIDEKDIRNVQLLPRET 362 Mycoplasma gallisepticum
Q6C700   424 LEWYLELRKQ-GSTPHGGFGMGFERLISYATGIENIRDVTAFPRWV 468 Yarrowia lipolytica
Q8BGV0   428 YQWYLDLRKF-GSVPHGGFGMGFERYLQCILGVDNIKDVIPFPRFT 472 house mouse
Q8U4D3   385 YEWYLDLRKY-GSVPHSGFGLGVERLVAWVLKLDHIRWASLFPRTp 429 Pyrococcus furiosus DSM 3638
Q8SQK8   402 YYWYLDMARF-GPCKHGGYGLGFERFLMGLMRYESVDEATLYPRKV 446 Encephalitozoon cuniculi GB-M1
O26328   388 FESYLSAFEY-GMPPHAGWGLGAERFNMTLTGLKNIRETVLFPRDR 432 Methanothermobacter thermautotrophicus str. Delta H
Q980V3   380 FEFFLKWFDY-GMPPHAGFGMGLARVMLMLTGLQSVKEVVPFPRDK 424 Sulfolobus solfataricus P2
EKC34078 772 LSWYLELREF-GSCPHGGFGMGFDRYLQFLLGMPSIKDVTAFPRWT 816 Pacific oyster
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap