1NIP


Conserved Protein Domain Family
Fer4_NifH

?
pfam00142: Fer4_NifH 
Click on image for an interactive view with Cn3D
4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family
Statistics
?
Aligned: 8 rows
Threshold Bit Score: 336.314
Threshold Setting Gi: 114867
Created: 19-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1NIP_A         3 RQCAIYGKGGIGKSTTTQNLVAALAEMG-KKVMIVGCDPKADSTRLILHSKAQNTIMEMAAEAGTV-EDLELEDVLKAGY 80  Azotobacter vin...
P00457         7 RQIAFYGKGGIGKSTTSQNTLAAMAEMG-QRIMIVGCDPKADSTRLMLHSKAQTTVLHLAAERGAV-EDLELHEVMLTGF 84  Nostoc sp. PCC ...
P26177        36 QIIAIYGKGGSGKSFTLANLSHMMAEMG-KRVLLIGCDPKSDTTSLLFGGKNCPTIIETATKKKLAgEEVKVGDVCFK-S 113 Rhodobacter cap...
Q6YXQ7         1 MKIAVYGKGGIGKSTTSCNISIALARRG-KKVLQIGCDPKHDST-FTLTGFLIPTIIDTLQLKDYHyEDVWPEDVIYKGY 78  Physcomitrella ...
WP_013180087   2 RKFCIYGKGGIGKSTNVGNMAAALAEDG-KKVLVVGCDPKADSTRTLMHGKIN-TVLDTFRDKGP--EYMKIEDIVYEGF 77  Methanococcus v...
WP_015614387   2 RQVAIYGKGGIGKSTTTQNLTSGLHAMG-KKIMVVGCDPKADSTRLLLGGLAQKSVLDTLREEG---EDVELDSILKDGY 77  Clostridium pas...
D5ANI3         5 RQIAFYGKGGIGKSTTSQNTLAALVEMG-QKILIVGCDPKADSTRLILNTKLQDTVLHLAAEAGSV-EDLEVEDVVKIGY 82  Rhodobacter cap...
WP_012703362   3 RKVAIYGKGGIGKSTTTQNTAAALAYFHdKKVFIHGCDPKADSTRLILGGKPQETLMDMLRDKGA--EKITNDDVIKKGF 80  Azotobacter vin...
1NIP_A        81 GGVKCVESGGPEPGVGCAGRGVITAINFLEEEGAYE-DdL--DFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMA 157 Azotobacter vin...
P00457        85 RGVKCVESGGPEPGVGCAGRGIITAINFLEENGAYQ-D-L--DFVSYDVLGDVVCGGFAMPIREGKAQEIYIVTSGEMMA 160 Nostoc sp. PCC ...
P26177       114 GGVFAMELGGPEVGRGCGGRGIIHGFELLEKLGFHDwD-F--DFVLLDFLGDVVCGGFGLPIARDMAQKVIVIGSNDLQS 190 Rhodobacter cap...
Q6YXQ7        79 GGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFY-E-Y--DIILFDVLGDVVCGGFAAPLN--YADYCIIITDNGFDA 152 Physcomitrella ...
WP_013180087  78 NGVYCVESGGPEPGVGCAGRGVITAVDMLDRLGVYD-E-LkpDVVMYDILGDVVCGGFAMPLQKRLAEDVYIVTTCDPMA 155 Methanococcus v...
WP_015614387  78 GGIRCVESGGPEPGVGCAGRGIITSINMLEQLGAYT-DdL--DYVFYDVLGDVVCGGFAMPIREGKAQEIYIVASGEMMA 154 Clostridium pas...
D5ANI3        83 KGIKCTEAGGPEPGVGCAGRGVITAINFLEENGAYD-D-V--DYVSYDVLGDVVCGGFAMPIRENKAQEIYIVMSGEMMA 158 Rhodobacter cap...
WP_012703362  81 LDIQCVESGGPEPGVGCAGRGVITAIDLMEENGAYT-DdL--DFVFFDVLGDVVCGGFAMPIRDGKAQEVYIVASGEMMA 157 Azotobacter vin...
1NIP_A       158 MYAANNISKGIVKYANSGS-VRLGGLICNSRNTDREDELIIALANKLGTQMIHFVPRDNVVQRAEIRRMTVIEYDPKAK- 235 Azotobacter vin...
P00457       161 MYAANNIARGILKYAHSGG-VRLGGLICNSRKVDREDELIMNLAERLNTQMIHFVPRDNIVQHAELRRMTVNEYAPDSN- 238 Nostoc sp. PCC ...
P26177       191 LYVANNVCNAVEYFRKLGGnVGVAGIVIN-K--DDGTGEAQAFAREVGIPILAAIPADEELRRKSAAYQIVGSHATPWG- 266 Rhodobacter cap...
Q6YXQ7       153 LFAANRIAASVREKARTHP-LRLAGLVGN-R--TSKRDLIDKYVEACPMPVLEVLPLIEDIRVSRVKGKTLFEMVESQPs 228 Physcomitrella ...
WP_013180087 156 IYAANNICKGIQRYGNRGK-IALGGIIYNGRSVVDEPEIIDKFVQGINTQVMGKIPMSNIITKAELRKQTTIEYAPDSE- 233 Methanococcus v...
WP_015614387 155 LYAANNISKGIQKYAKSGG-VRLGGIICNSRKVANEYELLDAFAKELGSQLIHFVPRSPMVTKAEINKQTVIEFDPTCE- 232 Clostridium pas...
D5ANI3       159 LYAANNIAKGILKYANSGG-VRLGGLICNERKTDRELELAEALAAKLGCKMIHFVPRNNVVQHAELRRETVIQYDPTCS- 236 Rhodobacter cap...
WP_012703362 158 IYAANNICKGLVKYAKQSG-VRLGGIICNSRKVDGEREFLEEFTAAIGTKMIHFVPRDNIVQKAEFNKKTVTEFAPEEN- 235 Azotobacter vin...
1NIP_A       236 ---QADEYRALARKVVDNK-LLVIPNPITMDELEELLMEFGIM 274 Azotobacter vinelandii
P00457       239 ---QGQEYRALAKKIINND-KLTIPTPMEMDELEALLIEYGLL 277 Nostoc sp. PCC 7120
P26177       267 -----KLFEELAGNVADAP--PLRPRPLSPDALLALFETDEET 302 Rhodobacter capsulatus SB 1003
Q6YXQ7       229 lnyVCDFYLNIADQILSQP-EGIVPKEVPDRELFSLLSDFYLN 270 Physcomitrella patens
WP_013180087 234 ---IANKFRELANAIYENK-KTTIPTPLSEQGLDDLTESIEEL 272 Methanococcus voltae
WP_015614387 233 ---QAEEYRELARKVDENK-LFVIPKPMTQERLEEILMQYGLM 271 Clostridium pasteurianum
D5ANI3       237 ---QAQEYRELARKIHENSgKGVIPTPITMEELEEMLMDFGIM 276 Rhodobacter capsulatus SB 1003
WP_012703362 236 ---QAKEYGELARKIIEND-EFVIPKPLTMDQLEDMVVKYGIA 274 Azotobacter vinelandii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap