1KQA,5B04


Conserved Protein Domain Family
Hexapep

?
pfam00132: Hexapep 
Click on image for an interactive view with Cn3D
Bacterial transferase hexapeptide (six repeats)
Statistics
?
PSSM-Id: 333866
View PSSM: pfam00132
Aligned: 218 rows
Threshold Bit Score: 27.3014
Threshold Setting Gi: 81637592
Created: 13-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30
                 ....*....|....*....|....*....|
1KQA_A       131 PITIGNNVWIGSHVVINPGVTIGDNSVIGA 160
gi 14285533  103 TVSIGNNCLIMPWAHIAHNCSVGNNVVFST 132
gi 166231993 106 MTRVGNNNLFMVGVHIGHDCKIGNNVVFAN 135
gi 1170826   108 VTAIGNNNLLMINVHVAHDCQIKNNCILAN 137
gi 67467363  108 LTKVGSDNLLMINAHIAHDCTVGNRCILAN 137
gi 226738535 108 ITKIGNDNLLMINTHVAHDCIIGDRCIIAN 137
gi 298286822 103 GTRIGSHNYWMAFSHAGHDCVVGDHNVFAN 132
gi 14285537  104 ETRIGDDNWIMAYCHLAHDCVIGNHTIFAN 133
gi 74582327  366 TTIMRNSVKVQAITVMGADCIVHDEVRVQN 395
gi 417035    382 DCIIGNNSIID-HSLIASNATLGSNVRLND 410
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap