1A6E,5X9U


Conserved Protein Domain Family
Cpn60_TCP1

?
pfam00118: Cpn60_TCP1 
Click on image for an interactive view with Cn3D
TCP-1/cpn60 chaperonin family
This family includes members from the HSP60 chaperone family and the TCP-1 (T-complex protein) family.
Statistics
?
PSSM-Id: 395068
View PSSM: pfam00118
Aligned: 52 rows
Threshold Bit Score: 246.345
Threshold Setting Gi: 68566294
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1A6E_A        34 IADAVRTTLGPKGMDKMLVDSIGDIIISNDGATILKEMDVEHPTAKMIVEVSKAQDTAVGDGTTTAVVLSGELLKQAETL 113 Thermoplasma ac...
Q5V6S3        24 LADAIRTTLGPNGLDKMVVGENGTVIVTNDGSKIIEWMDITHPVGRLVEQAAAAQDNTVGDGTTTAVVLVGALLEEAATL 103 Haloarcula mari...
XP_001307238  36 LSELTRTSIGPNGMKKIIKNHFGKLYVTGDAATILNEAEIQHPAAKMLVTASQMQAEQVGDGTNFVLVFGGELLRRATEL 115 Trichomonas vag...
Q7Q8S5        33 FANSVRSAYGPNGMNKMIINHIEKQFVTSDAGTIMRELDVEHPAAKLMIEASQMQEAEAGDGTNFVVVFCGALLEEAEEL 112 Anopheles gambi...
Q75HJ3        40 LSAITRTSLGPNGMNKMVINHLDKLFVTNDAATIVNELEVQHPAAKILVLAGRAQQEEIGDGANLTISFAGELLEKAEEL 119 Japanese rice
A0BPP6        36 ISNMTKTSLGPNGMKKMVVNHIDKIFVTSDAATILKEMEIQHPAAKMVLMAAKMQETEQGDATNFVITLAGELLQQAESL 115 Paramecium tetr...
Q5CTZ7        35 LSEMTQTSYGPNSMNKLIVNHLGKQFITSDLSTIIEELDIQHPAANMVVMACKRQAEEYGDASNTVLIFAGELLRNAAKL 114 Cryptosporidium...
XP_001611116  36 IADMLKTSLGPNGMKKLIVNHIEKRFVTSDCETILSGVDVQHPAAKVLAMAVQTMQNEFGDGTNTLIALAGEMLSNAALL 115 Babesia bovis T2Bo
Q4UIV8        36 ISDMLKTSLGPNSMKKLIVNHIDKKFVTSDCNTILAELEVVHPVGKIVLSSVESQKLQFGDGSNTLVALLGELLTNAGEL 115 Theileria annulata
Q38AE5        33 LAKITRSSMGPYGLCKMVINHLNKLFVTHDAATILRELEVEHPAAKLLVQASNAMQEEVGDGTNFVVSLAGELLSQAESL 112 Trypanosoma brucei
1A6E_A       114 ld-qGVHPTVISNGYRLAVNEARKII-DEIaEKSTDD-----ATLRKIALTALSGKNTGLSNDFLADLVVKAV-NAVAEV 185 Thermoplasma ac...
Q5V6S3       104 rs-aGLHPTTIIDGYGRAVEAALDQL-AQYeRGLHSRqd---drLTQIAKTAVTGRWDDASTDRFAELTLSAL-QAIG-- 175 Haloarcula mari...
XP_001307238 116 vr-aGINTKDIVAGYQKALAEALRILpTLD--LGNKFnvddkASVAACLKTPLSSHQYLDA-DFLSNIAAEAClMAYPNH 191 Trichomonas vag...
Q7Q8S5       113 lr-lGVTSSDITEGYEKALQKTLDILpTLS--CHEIKdyrslVPVRNAIRATVMSKQLGNE-DFLADLIAKACiSIMPEK 188 Anopheles gambi...
Q75HJ3       120 ir-mGLHPSEIIIGYTKAINKTVEILeDLVeKGSENMdvrnkEEVVLLMRSAVASKQFGQE-DILCPLVADACmQVCPKN 197 Japanese rice
A0BPP6       116 ik-lGLHPSQIVVGYETALKSALDLLdQQK--IWEITdvadeTQVLQAIRTSLSSKLSDYS-NLIAGLKRPVLi------ 185 Paramecium tetr...
Q5CTZ7       115 lndnGLHPSDIVAGYEIALERSLSLLnGMV--AHRVAnfknvSDLSGIVRPLVSTKNIGYS-DLITRLTCEAItSIMPDE 191 Cryptosporidium...
XP_001611116 116 ie-eGLHISDIRLGYELGYKRLLELFdNEV--VWEVSnirdeSQLKDVVGTCIAGKHISRP-EFITSLVAKACaSIIPPD 191 Babesia bovis T2Bo
Q4UIV8       116 lq-dGVHISDIRKGYEIAFNKLMEHLpSLV--CYNIKdlrdhESLRRVLYTAMNSKFSYMS-EFLSKLVTDAViSVMPTD 191 Theileria annulata
Q38AE5       113 vr-mGLHPSEIVEGYKKAGNKSLEILeTLT--VGTVDdvllkEQVMAPIRTAIASKQYGHD-SFLANLVVEACiNACPTN 188 Trypanosoma brucei
1A6E_A       186 RdgkTIVDTANIKVDKKNGGSVNDTQFI--SGIVIDKEKVHSKMp-------DVV---KNAKIALIDSALEIKKTeieAK 253 Thermoplasma ac...
Q5V6S3       176 ------FDRSRLTLKSYPGGELRESVCL--DGVLVDLETSSTSLntlshprtRTH---DEPAIAMVDAEIGIEEPnnvES 244 Haloarcula mari...
XP_001307238 192 N---LRFNVDNVRYAKALGGSIQDSFVV--KGFAIPREVVGTi---------RRK---DDVKIALYTCSFDFAETdtkMN 254 Trichomonas vag...
Q7Q8S5       189 T----TFNVDNIRVCKILGSGLQMSEVI--PGMVFKRFVEGEv---------TSA---TKAKIALYSCPVDIIQTetkGT 250 Anopheles gambi...
Q75HJ3       198 P---ANFNVDNVRVAKLLGGGLHNSSVV--RGMVLKNDAVGSi---------KRV---EKAKIAVFAGGVDTSATetkGT 260 Japanese rice
A0BPP6       186 ------LNMSE----------LQKSQVVqyQTVMFSQDl-------------LQLeilENPKICVFNAPLDPQSQetkGT 236 Paramecium tetr...
Q5CTZ7       192 Dk-lKEFNIDNVRIVKLLGGSPMQSFTI--NGMMVNREPGGTi---------RKLe--KVSNVMVLGCGLEMTGTeakGT 257 Cryptosporidium...
XP_001611116 192 A---KQFDVDNVRVLKITGGSLDQSSVM--NGMAIVREVSGMv---------KKV---GRTKVLVIAGGLEFAGTeakST 254 Babesia bovis T2Bo
Q4UIV8       192 V---SMFDPENIRVVKLTGGSLMESNLV--NGLVLIREPLGSv---------KKA---YNCRVLVLSVGLEFSGPetkGT 254 Theileria annulata
Q38AE5       189 T---RSFNVDNVRVAKLDGDCVLGSRNV--RGFVIARNPEGVv---------RHQ---KKAKIAVYACAVDVPSTetkGT 251 Trypanosoma brucei
1A6E_A       254 VQISDPSKIQDFLNQETNTFKQMVEKIKKSG-ANVVLCQKGIDDVAQHYLAKEGIYAVRRVKKSDMEKLAKATGAKIVTD 332 Thermoplasma ac...
Q5V6S3       245 VELQDATQRNAFQAHEQDRRTELVEQVVQSG-VTVLLCQKSIDEAVRTALAQRGVLPVERTRRDEFDVIARATGSTPVMS 323 Haloarcula mari...
XP_001307238 255 TVFTSGKQMEQFALSEENRMEQMVLSIKEKG-VNVVVCQSKFTELGIHYLEKHGIMAVQLPSNWDIKRLARAVKAVPLLR 333 Trichomonas vag...
Q7Q8S5       251 VLIKSADELKTFSQGEENLLEAQIKAIVDTG-ATVIVAGAKFGDMALHYMNKYGLMAVRLNSKFDLRRLSKAVGGTVLPR 329 Anopheles gambi...
Q75HJ3       261 VLIHSAEQLENYAKTEEAKVEELIKAVADSG-AKVIVSGAAVGDMALHFCERYKLMVLRISSKFELRRFCRTTGSIALLK 339 Japanese rice
A0BPP6       237 VLIKNATELMNYTKSEEELAEKIVKSIADAG-VNLIVAGGSISELVLHFVEKYKMMIVKVQSKFELKRLCKAIGASALSR 315 Paramecium tetr...
Q5CTZ7       258 VVLNNAQELLDFTRGEESLVENLIKDIKQTGkIDAIIAGGPISDIAQHFCNKYDILTLRITSKWELRRICRSIGAVAMVR 337 Cryptosporidium...
XP_001611116 255 VMLHSAEELLNFTKGEEAEMERVIRSIKDRG-VGCVIANGAVSDLALHYCNAMGIMVVKITSKFELRRLCRSLGATAVVK 333 Babesia bovis T2Bo
Q4UIV8       255 VLLKTAEQLLNYTKGEEREMETVIKSISDKG-VGVIVCNGAVSEMALHFCNKYNILVLKLVSKFDLRRVCRTTRSQAVMN 333 Theileria annulata
Q38AE5       252 ALIETADELLQFSRKEEEAMEEIITNIHKTG-VNVIVSNSTFGDLALHYLNRYGIMAVKVPSKFELRRLCAAVGARTLSR 330 Trypanosoma brucei
1A6E_A       333 L-------------DDLT-PSVLGEAETVEERKIGDDRMTF-VM---GCKNPKAVSILIRGGTDHVVSEVERALNDAIRV 394 Thermoplasma ac...
Q5V6S3       324 V-------------DDLT-ADDTGTVGSVTQRTVGTAQTLV-LQ---GCPEEHRATLLLRGGTPHVAEEVRRIVADCIDV 385 Haloarcula mari...
XP_001307238 334 I-------------GAPT-EDEIGHCKSVEAREIGSTPIVI-FEa-----dGEISTVIIRGATPNLIDDIERSLDDAVNS 393 Trichomonas vag...
Q7Q8S5       330 L-------------TPPS-TEELGYCDNVYLHELGDTSVTI-FKs--EGTESRIATVVIRGSTDNYMDDIERVIDDGVNT 392 Anopheles gambi...
Q75HJ3       340 L-------------SRPN-ADELGYADSVSVEEIGGARVTV-VKneeG--GNSVATVVLRGSTDSILDDLERAVDDGVNT 402 Japanese rice
A0BPP6       316 L-------------SAPM-PDELGTCDRVHVQEIGSQKVTI-FEk-qS-DTCKLATIVLRGATQNLLDDIERAIDDGVSC 378 Paramecium tetr...
Q5CTZ7       338 L-------------GVPL-PEEIGKASSIRVEEIGSKKVTV-INa----lNTKVSSVILRGATQGILDEMERAIANSVSV 398 Cryptosporidium...
XP_001611116 334 F-------------ESPS-EDDLGIVESVEMVDISSHKTLI-FQa----vDHRLSTIILKGATQGMLDEIERAIDDALCS 394 Babesia bovis T2Bo
Q4UIV8       334 LsqllpqpadlqngETPEvNEEFGYVESMELTEISSKKCVI-IRa----kDSRVNTIILKGATNNQLDEVERGIDDAVAL 408 Theileria annulata
Q38AE5       331 L-------------DTPT-VEDIGSCDNVDVTDAGGKNIISfVQdk---dDSKLSTIVVRGATKNVLDDVERAIDDGVNV 393 Trypanosoma brucei
1A6E_A       395 VAITKEDGKFLWGGGAVEAELAMRLaKYANS------------VGGREQLAIEAFAKALEIIPRTLAENAgidpINTLIK 462 Thermoplasma ac...
Q5V6S3       386 TRVALDDGVFVPGGGAVPTALAMDLaALSRE------------IPDRTQLVFDGFGTALEALPRTLATNAgtdpLTTLTE 453 Haloarcula mari...
XP_001307238 394 FRILTEHPLLVPGAGASEMELSTQIsKFAES------------RPGMDQYGIRKFAEALEVIPRTIAENSgiriSEFMAK 461 Trichomonas vag...
Q7Q8S5       393 FKGLTRDGRFLPGAGAVEIELAQQLaEYADT------------LPGLEQYAVRKFAKALEYFPKALAENSgvnaTEVVHQ 460 Anopheles gambi...
Q75HJ3       403 YKSMCRDSRIIPGAAATEIELARRLkEFSLK------------ETGLDQYAIAKFAESFEMVPRTLAENAglsaMEIISS 470 Japanese rice
A0BPP6       379 YRSLIKDARFVYGGGATEIKLAQLLeQEANK------------IKSIDQYAYRQYAQAFEIIPRILIENAglaqNEMMAQ 446 Paramecium tetr...
Q5CTZ7       399 VKSSTKDNRFVAGAGATFVELSKCLrAYDKSenkyqqnsvdvpVPGMEEYAVNMFAEALDVFPRLLAENSglnsTDLLAS 478 Cryptosporidium...
XP_001611116 395 ISAAIRDPRYLPGGGAFEIEMARQLaKFSQT------------LSGLEQHAARKFAESFEVIPKVLASNAghdaTVVITE 462 Babesia bovis T2Bo
Q4UIV8       409 VDNLKVDGKFLPGAGAVELQLSVLLkKFSDT------------VSGLERYAVEAFAKSLQVVPKILATNAgvdcETLLTN 476 Theileria annulata
Q38AE5       394 FKALTKDKRLVAGAGAVEMELQRKLkLFAET------------SPGLDQYAIHKFASSFEVVARTLAEVSgfngTDVVTQ 461 Trypanosoma brucei
1A6E_A       463 LKADD-EKGRiSVGVDLDNNG----VGDMKAKg------VVDPLRVKTHALESAVEVATMILRIDDVIASK 522 Thermoplasma acidophilum
Q5V6S3       454 IKQRH-DAGAeTVGVG-PDGH----PRDMIDAg------ILEPAAVFRSALQRAVAVVTQILRVDDVVRTS 512 Haloarcula marismortui
XP_001307238 462 IRASH-NKGEsSSGVDV-INMdignSIELg---------AWDIAHVKEWGMKFACEVACTLLRVDQICMAK 521 Trichomonas vaginalis G3
Q7Q8S5       461 LYLAH-KQGKkTEGFDIESEQp--aTIDVTTKn------IFDLYTTKYWGLKYAVGAACTILKVDEIIMAK 522 Anopheles gambiae str. PEST
Q75HJ3       471 LYAEH-AGGNtKVGIDLEEGG----CKDVSIMk------IWDLYVTKLFALKYSADAACTVLRVDQIIMAK 530 Japanese rice
A0BPP6       447 MHKLN---SEkPHSLNI-STAtlspSQDLk---------VFDHLKTKWWAIKLATDAAVTILRVDQIIIAK 504 Paramecium tetraurelia
Q5CTZ7       479 LHAIHqQGSQpHKGINVFCGSgtspIIDCISNneqgvglIVDHLGTLCSALKLATDSAVTILKIDEIIMAK 549 Cryptosporidium parvum
XP_001611116 463 LYAAH-DSGDrFACVSS-DLEs--rLSDAKLEr------VYDHYIVKMFSIKLAYEAVSTILSVDQLIMAK 523 Babesia bovis T2Bo
Q4UIV8       477 LLSLH-ENGKiHSCV---DIEtg-sCGDSVELk------VFDHYQTKHNLLTLCYEALMTILTVDQIIVAK 536 Theileria annulata
Q38AE5       462 LEIDH-NAGKvHNGVGVEDGT----TIDSLEAg------IVEPYLTKYWAINLATEAVVTVLQVNQIIVAK 521 Trypanosoma brucei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap