1A6D


Conserved Protein Domain Family
Cpn60_TCP1

?
pfam00118: Cpn60_TCP1 
Click on image for an interactive view with Cn3D
TCP-1/cpn60 chaperonin family
This family includes members from the HSP60 chaperone family and the TCP-1 (T-complex protein) family.
Statistics
?
PSSM-Id: 333853
View PSSM: pfam00118
Aligned: 58 rows
Threshold Bit Score: 245.181
Threshold Setting Gi: 68566294
Created: 14-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1A6D_A        34 IADAVRTTLGPKGMDKMLVDSIGDIIISNDGATILKEMDVEHPTAKMIVEVSKAQDTAVGDGTTTAVVLSGELLKQAETL 113 Thermoplasma ac...
Q38AE5        33 LAKITRSSMGPYGLCKMVINHLNKLFVTHDAATILRELEVEHPAAKLLVQASNAMQEEVGDGTNFVVSLAGELLSQAESL 112 Trypanosoma brucei
Q75HJ3        40 LSAITRTSLGPNGMNKMVINHLDKLFVTNDAATIVNELEVQHPAAKILVLAGRAQQEEIGDGANLTISFAGELLEKAEEL 119 Japanese rice
Q7Q8S5        33 FANSVRSAYGPNGMNKMIINHIEKQFVTSDAGTIMRELDVEHPAAKLMIEASQMQEAEAGDGTNFVVVFCGALLEEAEEL 112 Anopheles gambi...
A0BPP6        36 ISNMTKTSLGPNGMKKMVVNHIDKIFVTSDAATILKEMEIQHPAAKMVLMAAKMQETEQGDATNFVITLAGELLQQAESL 115 Paramecium tetr...
Q5CTZ7        35 LSEMTQTSYGPNSMNKLIVNHLGKQFITSDLSTIIEELDIQHPAANMVVMACKRQAEEYGDASNTVLIFAGELLRNAAKL 114 Cryptosporidium...
Q4UIV8        36 ISDMLKTSLGPNSMKKLIVNHIDKKFVTSDCNTILAELEVVHPVGKIVLSSVESQKLQFGDGSNTLVALLGELLTNAGEL 115 Theileria annulata
Q4Z776        18 ISSILQTSFGPKCMNKLIVNHINKKIVSSDCITILNDLEINHPVVNILKKLSETMNYEYGDNTNYVFTIATEMLEKASYL 97  Plasmodium berghei
XP_001611116  36 IADMLKTSLGPNGMKKLIVNHIEKRFVTSDCETILSGVDVQHPAAKVLAMAVQTMQNEFGDGTNTLIALAGEMLSNAALL 115 Babesia bovis T2Bo
EGA74449      61 LHQMCLTSMGPCGRNKIIVNHLGKIIITNDAATMLRELDIVHPAVKVLVMATEQQKIDMGDGTNLVMILAGELLNVSEKL 140 Saccharomyces c...
1A6D_A       114 ld-qGVHPTVISNGYRLAVNEARKII-DEIa-EKSTDda----tLRKIALTALSGKNTGLSNDFLADLVVKAV-NAV--A 183 Thermoplasma ac...
Q38AE5       113 vr-mGLHPSEIVEGYKKAGNKSLEILeTLT--VGTVDdvllkeqVMAPIRTAIASKQYGHD-SFLANLVVEACiNAC--P 186 Trypanosoma brucei
Q75HJ3       120 ir-mGLHPSEIIIGYTKAINKTVEILeDLVekGSENMdvrnkeeVVLLMRSAVASKQFGQE-DILCPLVADACmQVC--P 195 Japanese rice
Q7Q8S5       113 lr-lGVTSSDITEGYEKALQKTLDILpTLS--CHEIKdyrslvpVRNAIRATVMSKQLGNE-DFLADLIAKACiSIM--P 186 Anopheles gambi...
A0BPP6       116 ik-lGLHPSQIVVGYETALKSALDLLdQQK--IWEITdvadetqVLQAIRTSLSSKLSDYS-NLIAGLKRPVLi------ 185 Paramecium tetr...
Q5CTZ7       115 lndnGLHPSDIVAGYEIALERSLSLLnGMV--AHRVAnfknvsdLSGIVRPLVSTKNIGYS-DLITRLTCEAItSIM--P 189 Cryptosporidium...
Q4UIV8       116 lq-dGVHISDIRKGYEIAFNKLMEHLpSLV--CYNIKdlrdhesLRRVLYTAMNSKFSYMS-EFLSKLVTDAViSVM--P 189 Theileria annulata
Q4Z776        98 ih-dGFNVNDILNGFKLGYNEIDKILeESI--SFKIEnfydekeIFKVIKSAMGTKKLSNSYDFLINLLSKCLsTLM--P 172 Plasmodium berghei
XP_001611116 116 ie-eGLHISDIRLGYELGYKRLLELF-DNEv-VWEVSnirdesqLKDVVGTCIAGKHISRP-EFITSLVAKAC-ASIipP 190 Babesia bovis T2Bo
EGA74449     141 is-mGLSAVEIIQGYNMARKFTLKEL-DEMvvGEITDknd-kneLLKMIKPVISSKKYGSE-DILSELVSEAVsHVL--P 214 Saccharomyces c...
1A6D_A       184 evrd--gktiVDTANIKVDKKNGGSVNDTQFI--SGIVIDKEKVHS-KMPDVV---KNAKIALIDSALEIKKTeieAKVQ 255 Thermoplasma ac...
Q38AE5       187 tnt-----rsFNVDNVRVAKLDGDCVLGSRNV--RGFVIARNPEGV---VRHQ---KKAKIAVYACAVDVPSTetkGTAL 253 Trypanosoma brucei
Q75HJ3       196 knp-----anFNVDNVRVAKLLGGGLHNSSVV--RGMVLKNDAVGS---IKRV---EKAKIAVFAGGVDTSATetkGTVL 262 Japanese rice
Q7Q8S5       187 ek------ttFNVDNIRVCKILGSGLQMSEVI--PGMVFKRFVEGE---VTSA---TKAKIALYSCPVDIIQTetkGTVL 252 Anopheles gambi...
A0BPP6       186 ----------LNMSE----------LQKSQVVqyQTVMFSQD-------LLQLeilENPKICVFNAPLDPQSQetkGTVL 238 Paramecium tetr...
Q5CTZ7       190 dedk---lkeFNIDNVRIVKLLGGSPMQSFTI--NGMMVNREPGGT---IRKLe--KVSNVMVLGCGLEMTGTeakGTVV 259 Cryptosporidium...
Q4UIV8       190 tdv-----smFDPENIRVVKLTGGSLMESNLV--NGLVLIREPLGS---VKKA---YNCRVLVLSVGLEFSGPetkGTVL 256 Theileria annulata
Q4Z776       173 eki-----etFDVDNIRITKLNGGNLIDSQFL--MGMVISKEPNGI---VKKK---ENAQIMILNCGLEAATTetkGTVL 239 Plasmodium berghei
XP_001611116 191 da------kqFDVDNVRVLKITGGSLDQSSVM--NGMAIVREVSG---MVKKV---GRTKVLVIAGGLEFAGTeakSTVM 256 Babesia bovis T2Bo
EGA74449     215 vaqqageipyFNVDSIRVVKIMGGSLSNSTVI--KGMVFNREPEGHvK---SLsedKKHKVAVFTCPLDIANTetkGTVL 289 Saccharomyces c...
1A6D_A       256 ISDPSKIQDFLNQETNTFKQMVEKIKKSG-ANVVLCQKGIDDVAQHYLAKEGIYAVRRVKKSDMEKLAKATGAKIVTDL- 333 Thermoplasma ac...
Q38AE5       254 IETADELLQFSRKEEEAMEEIITNIHKTG-VNVIVSNSTFGDLALHYLNRYGIMAVKVPSKFELRRLCAAVGARTLSRL- 331 Trypanosoma brucei
Q75HJ3       263 IHSAEQLENYAKTEEAKVEELIKAVADSG-AKVIVSGAAVGDMALHFCERYKLMVLRISSKFELRRFCRTTGSIALLKL- 340 Japanese rice
Q7Q8S5       253 IKSADELKTFSQGEENLLEAQIKAIVDTG-ATVIVAGAKFGDMALHYMNKYGLMAVRLNSKFDLRRLSKAVGGTVLPRL- 330 Anopheles gambi...
A0BPP6       239 IKNATELMNYTKSEEELAEKIVKSIADAG-VNLIVAGGSISELVLHFVEKYKMMIVKVQSKFELKRLCKAIGASALSRL- 316 Paramecium tetr...
Q5CTZ7       260 LNNAQELLDFTRGEESLVENLIKDIKQTGkIDAIIAGGPISDIAQHFCNKYDILTLRITSKWELRRICRSIGAVAMVRL- 338 Cryptosporidium...
Q4UIV8       257 LKTAEQLLNYTKGEEREMETVIKSISDKG-VGVIVCNGAVSEMALHFCNKYNILVLKLVSKFDLRRVCRTTRSQAVMNLs 335 Theileria annulata
Q4Z776       240 LRNAQELVNFTKGEEDQMKKIIENIKQAG-VDVIIVNGAISDIAQHFCDANDIMTLKITSKFETIRICKLLNIHSLVKL- 317 Plasmodium berghei
XP_001611116 257 LHSAEELLNFTKGEEAEMERVIRSIKDRG-VGCVIANGAVSDLALHYCNAMGIMVVKITSKFELRRLCRSLGATAVVKF- 334 Babesia bovis T2Bo
EGA74449     290 LHNAQEMLDFSKGEEKQIDAMMKEIADMG-VECIVAGAGVGELALHYLNRYGILVLKVPSKFELRRLCRVCGATPLPRL- 367 Saccharomyces c...
1A6D_A       334 ------------DDLT-PSVLGEAETVEERKIGDDRMTF-VM---GCKNPKAVSILIRGGTDHVVSEVERALNDAIRVVA 396 Thermoplasma ac...
Q38AE5       332 ------------DTPT-VEDIGSCDNVDVTDAGGKNIISfVQdk---dDSKLSTIVVRGATKNVLDDVERAIDDGVNVFK 395 Trypanosoma brucei
Q75HJ3       341 ------------SRPN-ADELGYADSVSVEEIGGARVTV-VKneeG--GNSVATVVLRGSTDSILDDLERAVDDGVNTYK 404 Japanese rice
Q7Q8S5       331 ------------TPPS-TEELGYCDNVYLHELGDTSVTI-FKs--EGTESRIATVVIRGSTDNYMDDIERVIDDGVNTFK 394 Anopheles gambi...
A0BPP6       317 ------------SAPM-PDELGTCDRVHVQEIGSQKVTI-FEk-qS-DTCKLATIVLRGATQNLLDDIERAIDDGVSCYR 380 Paramecium tetr...
Q5CTZ7       339 ------------GVPL-PEEIGKASSIRVEEIGSKKVTV-INa----lNTKVSSVILRGATQGILDEMERAIANSVSVVK 400 Cryptosporidium...
Q4UIV8       336 qllpqpadlqngETPEvNEEFGYVESMELTEISSKKCVI-IRa----kDSRVNTIILKGATNNQLDEVERGIDDAVALVD 410 Theileria annulata
Q4Z776       318 ------------RTPE-PEEIGKVSSIYVTEIASKKVTI-INs----kNKKLGTILLRGATTNLLDETERCIHDGINAIK 379 Plasmodium berghei
XP_001611116 335 ------------ESPS-EDDLGIVESVEMVDISSHKTLI-FQ---AVDH-RLSTIILKGATQGMLDEIERAIDDALCSIS 396 Babesia bovis T2Bo
EGA74449     368 ------------GAPT-PEELGLVETVKTMEIGGDRVTV-FKq-eQGEISRTSTIILRGATQNNLDDIERAIDDGVAAVK 432 Saccharomyces c...
1A6D_A       397 ITKE--DGKFLWGGGAVEAELAMRLaKYANS------------VGGREQLAIEAFAKALEIIPRTLAENAgidpINTLIK 462 Thermoplasma ac...
Q38AE5       396 ALTK--DKRLVAGAGAVEMELQRKLkLFAET------------SPGLDQYAIHKFASSFEVVARTLAEVSgfngTDVVTQ 461 Trypanosoma brucei
Q75HJ3       405 SMCR--DSRIIPGAAATEIELARRLkEFSLK------------ETGLDQYAIAKFAESFEMVPRTLAENAglsaMEIISS 470 Japanese rice
Q7Q8S5       395 GLTR--DGRFLPGAGAVEIELAQQLaEYADT------------LPGLEQYAVRKFAKALEYFPKALAENSgvnaTEVVHQ 460 Anopheles gambi...
A0BPP6       381 SLIK--DARFVYGGGATEIKLAQLLeQEANK------------IKSIDQYAYRQYAQAFEIIPRILIENAglaqNEMMAQ 446 Paramecium tetr...
Q5CTZ7       401 SSTK--DNRFVAGAGATFVELSKCLrAYDKSenkyqqnsvdvpVPGMEEYAVNMFAEALDVFPRLLAENSglnsTDLLAS 478 Cryptosporidium...
Q4UIV8       411 NLKV--DGKFLPGAGAVELQLSVLLkKFSDT------------VSGLERYAVEAFAKSLQVVPKILATNAgvdcETLLTN 476 Theileria annulata
Q4Z776       380 NSIK--SNSFVYGGGCTEVQLYSKIkQLSQK------------LTGIDNYSVKMFAESFLSIPRILATNSgynnTDVVNR 445 Plasmodium berghei
XP_001611116 397 AAIR--DPRYLPGGGAFEIEMARQLaKFSQT------------LSGLEQHAARKFAESFEVIPKVLASNAghdaTVVITE 462 Babesia bovis T2Bo
EGA74449     433 GLMKpsGGKLLPGAGATEIELISRItKYGER------------TPGLLQLAIKQFAVAFEVVPRTLAETAgldvNEVLPN 500 Saccharomyces c...
1A6D_A       463 LKADD-EKGRi----------SVGV--DlDNNG----VGDMKAKG------VVDPLRVKTHALESAVEVATMILRIDDVI 519 Thermoplasma ac...
Q38AE5       462 LEIDH-NAGKv----------HNGV--GvEDGT----TIDSLEAG------IVEPYLTKYWAINLATEAVVTVLQVNQII 518 Trypanosoma brucei
Q75HJ3       471 LYAEH-AGGNt----------KVGI--DlEEGG----CKDVSIMK------IWDLYVTKLFALKYSADAACTVLRVDQII 527 Japanese rice
Q7Q8S5       461 LYLAH-KQGKk----------TEGF--DiESEQp--aTIDVTTKN------IFDLYTTKYWGLKYAVGAACTILKVDEII 519 Anopheles gambi...
A0BPP6       447 MHKLN---SEk----------PHSL--Ni-STAtlspSQDL---K------VFDHLKTKWWAIKLATDAAVTILRVDQII 501 Paramecium tetr...
Q5CTZ7       479 LHAIHqQGSQp----------HKGI--NvFCGSgtspIIDCISNNeqgvglIVDHLGTLCSALKLATDSAVTILKIDEII 546 Cryptosporidium...
Q4UIV8       477 LLSLH-ENGKi----------HSCV-----DIEtg-sCGDSVELK------VFDHYQTKHNLLTLCYEALMTILTVDQII 533 Theileria annulata
Q4Z776       446 LISEH-SKGNl----------EACV--Ni-NRNde-fIISAKTNN------IYDNLKCKKYAIDLAFESLQTILKIDQII 504 Plasmodium berghei
XP_001611116 463 LYAAH-DSGDr----------FACVssDlES-R----LSDAKLER------VYDHYIVKMFSIKLAYEAVSTILSVDQLI 520 Babesia bovis T2Bo
EGA74449     501 LYAAH-NVTEpgavktdhlykGVDI--DgESDEg---VKDIREEN------IYDMLATKKFAINVATEAATTVLSIDQII 568 Saccharomyces c...
1A6D_A       520 ASK 522 Thermoplasma acidophilum
Q38AE5       519 VAK 521 Trypanosoma brucei
Q75HJ3       528 MAK 530 Japanese rice
Q7Q8S5       520 MAK 522 Anopheles gambiae str. PEST
A0BPP6       502 IAK 504 Paramecium tetraurelia
Q5CTZ7       547 MAK 549 Cryptosporidium parvum
Q4UIV8       534 VAK 536 Theileria annulata
Q4Z776       505 LAK 507 Plasmodium berghei
XP_001611116 521 MAK 523 Babesia bovis T2Bo
EGA74449     569 MAK 571 Saccharomyces cerevisiae AWRI796
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap