4WYR,2WKT,4O99,5F0V


Conserved Protein Domain Family
Thiolase_N

?
pfam00108: Thiolase_N 
Click on image for an interactive view with Cn3D
Thiolase, N-terminal domain
Thiolase is reported to be structurally related to beta-ketoacyl synthase (pfam00109), and also chalcone synthase.
Statistics
?
PSSM-Id: 333844
View PSSM: pfam00108
Aligned: 34 rows
Threshold Bit Score: 172.103
Threshold Setting Gi: 1221660129
Created: 13-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4WYR_A         4 VVIASAVRTAIGS-YGKSLKDVPAVDLGATAIKEAVKKAGIKPEDVNEVILGNVLQA-GLGQN-PARQASFKAGLPQEIP 80  Clostridium ace...
Q05493        30 VVITAAYRTAHTKgGKGLFKDTSSSELLASLLEGLVKESKIDPKLIGDVVCGNVLAA-GAGAT-EHRAACLVAGIPETVP 107 Yarrowia lipoly...
P33290        27 VVIVAAYRTAIGKgFKGSFRSVRSEFILTEFLKEFIKKTNIDPSLIEDVAIGNVLNQ-AAGAT-EHRGACLAAGIPYTAA 104 Candida tropicalis
Q3IPN4         4 VAVIGASMTNFGT------REKWIRELLAEAGKDCLDDAGVTPGEVDHLYVSNMASGeFEGQTgIQNALAHDLSV-VPAY 76  Natronomonas ph...
WP_007142856   4 VAIIGASMTQFGQ-----REDEWILDLLAEAGLECLEDAGVDAADVEHLYVSNMASGeFEGQTgVPNALAHDIDA-VPAY 77  Halobiforma lac...
AGB16172       4 VAIIGTSMTQFGN------RSAWIRELLAEAGHSCLASAGVDPNALDHLYVSNMAAGeFEGQTgVSNALAHDLGA-LPAY 76  Halovivax ruber...
WP_012660230   5 VAIIGGSMTKFGE------RDAWVRELLAEAGEACLDDAGVTPDDVEHVYVSNMASGeFEGQTgIMNALAHDLGL-MPAY 77  Halorubrum lacu...
WP_004961328   3 VAVIGASMTKFGQ------RDVWIRELLSQAGEECLTDAGVAPDDVEHLYVSNMASGeFEGQTgIMNLLAHDLGV-LPAY 75  Haloarcula sina...
WP_006056092   4 VAVISASMTQFGN-----REGQFILDLLAEAGEACLDDVGVSPDSVDHLYVSNMASGeFEGQTgIPNALAHDLSM-LPAY 77  Halogeometricum...
ADB61594      19 VAIAGAAMTPFGP------REASLLELLAEAGTDCLADAPIGTDEVDHLFVARSGGA-YEGQSgLAAALAGELGI-RPAH 90  Haloterrigena t...
4WYR_A        81 AMTINKVCGSGLRTVSLAAQIIKAGDADVIIAGGMENMSRAPYLAN-NAR-WGYRMGNAKFVDEMITDglwdafydyHMG 158 Clostridium ace...
Q05493       108 FVALNRQCSSGLMAVNDVANKIRAGQIDIGIGCGVESMSNQYGPNSvTPF-SNKFQNNEEAKKCLIPM-----------G 175 Yarrowia lipoly...
P33290       105 FIAVNRFCSSGLMAISDIANKIKTGEIECGLAGGAESMSTNYRDPRvAPRiDPHLADDAQMEKCLIPM-----------G 173 Candida tropicalis
Q3IPN4        77 AQRVGQTSSSGAAGIYAAWQSIASGASEMTLLVGGEKMTHRTTGESsDII-ASITHPVEYKHGVTLPS---------FAG 146 Natronomonas ph...
WP_007142856  78 TQRVDQTSSSGGAGIYAAWQSVASGASDMTLLVGGEKMTHRTTGEAtDVI-ASLTHPAEYKHGVTLPS---------FAG 147 Halobiforma lac...
AGB16172      77 TERVDQTSASGGAGIYAAWRSIASGASDMTLLVGGEKMTHRSTSEAtDVI-ASLTHPVEYKHGLTLPS---------FAG 146 Halovivax ruber...
WP_012660230  78 SQRIDQTSSSGAAGIYGAWQSVASGASDMTLLVGGEKMTHKDTAGStEVI-ASITHPEEYKHGVTLPS---------FAG 147 Halorubrum lacu...
WP_004961328  76 SERVDQTSSSGGAGIYEAWQSVASGASEMTLLVGGEKMTHKTTGQAtDII-ASITHPDEYKHGVTLPS---------FAG 145 Haloarcula sina...
WP_006056092  78 TTRIDQTSSSGGAGVYAAWQSIASGASEMTLLVGGEKMTHRSTADTtDII-ASITHPVEYKHGITLPT---------FAG 147 Halogeometricum...
ADB61594      91 AVAIEQTSSSGAAAVYEAWKAIASGTCEVALAVGGERMTHLSTATAtDIV-SGITHPAEYRHGITIPS---------FAG 160 Haloterrigena t...
4WYR_A       159 ITAENIAERWNISREEQDEFALASQKKAEEAIKSGQFKDeIVPVVIKGRKGEt-----VVDTDEHPRFgSTIEGLAKLKP 233 Clostridium ace...
Q05493       176 ITSENVAAKYNVSRKAQDAFAAKSYEKAAAAQAAGKFDQeILPIKTTVLDDDdnekevTVNKDDGIRPgVTAEKLGKLKP 255 Yarrowia lipoly...
P33290       174 ITNENVANQFNISRERQDEFAAKSYNKAAKAVAAGAFKSeILPIRSIIRNSDgtekeiIVDTDEGPREgVTAESLGKLRP 253 Candida tropicalis
Q3IPN4       147 LAARLYLDEYDAPRESLAEVAVKNHHNGVKNPDAQ-FKKkI-------------------DVETALESpLVADPLRLY-- 204 Natronomonas ph...
WP_007142856 148 LTARHYLEKFDAPRESLAKVAVKNHRNGVDNPNAQ-FRKeI-------------------DEETALESpIVADPLRLY-- 205 Halobiforma lac...
AGB16172     147 LTARRYLDRYEAPRESLASVAAKNHRNGVDNPKAQ-FQKaV-------------------SKETILESpIVADPLRLY-- 204 Halovivax ruber...
WP_012660230 148 MTARLYLDKYDAPRESLAKVAIKNHKNGVDNPKAQ-FQKeI-------------------DIETAMESpIIADPLRLY-- 205 Halorubrum lacu...
WP_004961328 146 MTARHYLERFDAPRESLARVAVKNHRNGVDNPKAQ-FQKeI-------------------TMEKALESpIIADPLRLY-- 203 Haloarcula sina...
WP_006056092 148 LTARRYLHEYDAPRESLARVAVKNHANGVDNPHAQ-FRKeI-------------------TLEDALEApVIADPLRLY-- 205 Halogeometricum...
ADB61594     161 LTARRYLERYDAPRTALAKVAVKNHAHGVANPKAH-FRReI-------------------DVETVLDSpVVADPLRLY-- 218 Haloterrigena t...
4WYR_A       234 AFKKDGTVTAGNASGLNDCAAVLVIMSAE 262 Clostridium acetobutylicum ATCC 824
Q05493       256 AFSAEGTTHAGNASQISDGAGAVLLMRRS 284 Yarrowia lipolytica CLIB122
P33290       254 AFD--GTTTAGNASQVSDGAAAVLLMKRS 280 Candida tropicalis
Q3IPN4       205 -----------DYCPVTDGSAALLFCPVD 222 Natronomonas pharaonis DSM 2160
WP_007142856 206 -----------DFCPITDGSAALMLCPES 223 Halobiforma lacisalsi
AGB16172     205 -----------DFCPITDGSAALLFCPES 222 Halovivax ruber XH-70
WP_012660230 206 -----------DFCPVTDGSAALMFCPVD 223 Halorubrum lacusprofundi
WP_004961328 204 -----------DFCPITDGSAALMFTTEE 221 Haloarcula sinaiiensis
WP_006056092 206 -----------DFCPISDGSAALLFCPES 223 Halogeometricum borinquense
ADB61594     219 -----------DFCPISDGSAALLLVAES 236 Haloterrigena turkmenica DSM 5511
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap