4IQR,3DZU,2A66,1HRA,2EBL,1KB2,1HLZ,5CC1,2HAN,1CIT,4OLN,2NLL


Conserved Protein Domain Family
zf-C4

?
pfam00105: zf-C4 
Click on image for an interactive view with Cn3D
Zinc finger, C4 type (two domains)
In nearly all cases, this is the DNA binding domain of a nuclear hormone receptor. The alignment contains two Zinc finger domains that are too dissimilar to be aligned with each other.
Statistics
?
PSSM-Id: 333841
View PSSM: pfam00105
Aligned: 38 rows
Threshold Bit Score: 105.379
Threshold Setting Gi: 4930008
Created: 14-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
4IQR_A         20 LCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMK 87
gi 127819     266 RCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMV 333
gi 416584      12 LCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKTQRKRCPFCRFQKCLTVGMR 79
gi 1018618719 559 TCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMT 626
gi 121069     420 LCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMN 487
gi 215274146   78 LCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNECEITKRRRKACQACRFTKCLRVGML 145
gi 119597     178 YCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMM 245
2A66_A         11 LCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKRCPYCRFQKCLSVGMK 78
5CC1_A         28 LCLVCGDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMN 95
1CIT_A          2 rCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKSAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMV 69
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap