5SZI,1TU3


Conserved Protein Domain Family
Ras

?
pfam00071: Ras 
Click on image for an interactive view with Cn3D
Ras family
Includes sub-families Ras, Rab, Rac, Ral, Ran, Rap Ypt1 and more. Shares P-loop motif with GTP_EFTU, arf and myosin_head. See pfam00009 pfam00025, pfam00063. As regards Rab GTPases, these are important regulators of vesicle formation, motility and fusion. They share a fold in common with all Ras GTPases: this is a six-stranded beta-sheet surrounded by five alpha-helices.
Statistics
?
PSSM-Id: 333814
View PSSM: pfam00071
Aligned: 62 rows
Threshold Bit Score: 177.7
Threshold Setting Gi: 166208513
Created: 13-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5SZI_A  12 KLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIgIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD 91  human
P08647  10 KLVVVGDGGVGKSALTIQLIQSHFVDEYDPTI-EDSYRKKCEIDGEGALLDVLDTAGQEEYSAMREQYMRTGEGFLLVYN 88  Schizosaccharomyces p...
P22126  10 KLVVVGGGGVGKSCLTIQLIQGHFLDEYDPTI-EDSYRKQCTIDNEVALLDILDTAGQEEYSAMREQYMRTGEGFLLVFA 88  Neurospora crassa OR74A
P10301  31 KLVVVGGGGVGKSALTIQFIQSYFVSDYDPTI-EDSYTKICSVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFA 109 human
P04388   7 KLVVVGGGGVGKSAITIQFIQSYFVTDYDPTI-EDSYTKQCNIDDVPAKLDILDTAGQEEFSAMREQYMRSGEGFLLVFA 85  fruit fly
P01120  12 KLVVVGGGGVGKSALTIQLTQSHFVDEYDPTI-EDSYRKQVVIDDEVSILDILDTAGQEEYSAMREQYMRNGEGFLLVYS 90  Saccharomyces cerevis...
P32254   5 KLVLVGPGGVGKSCLTIQFIAQKFVDEYDPTL-EDSYRKQTTVDGEECLLDIYDTAGQEDFSAVRDQYMRTGEGFLCVYS 83  Dictyostelium discoideum
P11233  16 KVIMVGSGGVGKSALTLQFMYDEFVEDYEPTK-ADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFS 94  human
P25378  18 KIALIGARNVGKTTLTVRFVESRFVESYYPTI-ENEFTRIIPYKSHDCTLEILDTAGQDEVSLLNIKSLTGVRGIILCYS 96  Saccharomyces cerevis...
P22278  12 KLVMVGGGGVGKSALTIQFIQSHFVDEYDPTI-EDSYRKQCVIDSETALLDVLDTAGQEEYSAMREQYMRNGEGFLLVYS 90  Mucor circinelloides ...
5SZI_A  92 ITNEKSFDNIRNWIRNIEEHAS--AdVEKMILGNKCDVNd-----KRQVSKERGEKLA-------LDYGIKFMETSAKAN 157 human
P08647  89 ITSRSSFDEISTFYQQILRVKDkdT-FPVVLVANKCDLEa-----ERVVSRAEGEQLA-------KSMHCLYVETSAKLR 155 Schizosaccharomyces p...
P22126  89 INSRESFEEIRIYQQQILRVKDrdS-FPMIIVGNKYDLRg-----ERVVSEQEGQALA-------AEFGTKYIETSAKTQ 155 Neurospora crassa OR74A
P10301 110 INDRQSFNEVGKLFTQILRVKDrdD-FPVVLVGNKADLEs-----QRQVPRSEASAFG-------ASHHVAYFEASAKLR 176 human
P04388  86 LNDHSSFDEIPKFQRQILRVKDrdE-FPMLMVGNKCDLKh-----QQQVSLEEAQNTS-------RNLMIPYIECSAKLR 152 fruit fly
P01120  91 ITSKSSLDELMTYYQQILRVKDtdY-VPIVVVGNKSDLEn-----EKQVSYQDGLNMA-------KQMNAPFLETSAKQA 157 Saccharomyces cerevis...
P32254  84 ITYLQSFKEIHRLHNHLLKVKDldS-VPFVLVGNKCDLNe-----YREVSTAEGEELA-------KKLNCKFLETSAKER 150 Dictyostelium discoideum
P11233  95 ITEMESFAATADFREQILRVKEd-EnVPFLLVGNKSDLEd-----KRQVSVEEAKNRA-------EQWNVNYVETSAKTR 161 human
P25378  97 IINRASFDLIPILWDKLVDQLGkdN-LPVILVGTKADLGrstkgvkRCVTKAEGEKLAstigsqdKRNQAAFIECSAELD 175 Saccharomyces cerevis...
P22278  91 ITSRLSFEEITTFYQQICRVKDr-DyFPMVLVGNKCDLEg-----DRQVSSQEGRDLA-------KNFGCQFIETSAKQR 157 Mucor circinelloides ...
5SZI_A 158 INVENAFFTLARDIK 172 human
P08647 156 LNVEEAFYSLVRTIR 170 Schizosaccharomyces pombe 972h-
P22126 156 HNVENAFYDLVREIR 170 Neurospora crassa OR74A
P10301 177 LNVDEAFEQLVRAVR 191 human
P04388 153 VNVDQAFHELVRIVR 167 fruit fly
P01120 158 INVEEAFYTLARLVR 172 Saccharomyces cerevisiae S288c
P32254 151 INVSESFYELVREVK 165 Dictyostelium discoideum
P11233 162 ANVDKVFFDLMREIR 176 human
P25378 176 YNVEETFMLLLKQME 190 Saccharomyces cerevisiae S288c
P22278 158 INVDEAFFEVVRDIR 172 Mucor circinelloides f. lusitanicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap