1S8F,4PHF,5XR7,3CPJ,1Z0A,2BME,4LHV,1G16,4RKF,1UKV,1EK0,3ICQ,1KAO,2FN4,1ZC3


Conserved Protein Domain Family
Ras

?
pfam00071: Ras 
Click on image for an interactive view with Cn3D
Ras family
Includes sub-families Ras, Rab, Rac, Ral, Ran, Rap Ypt1 and more. Shares P-loop motif with GTP_EFTU, arf and myosin_head. See pfam00009 pfam00025, pfam00063. As regards Rab GTPases, these are important regulators of vesicle formation, motility and fusion. They share a fold in common with all Ras GTPases: this is a six-stranded beta-sheet surrounded by five alpha-helices.
Statistics
?
PSSM-Id: 395024
View PSSM: pfam00071
Aligned: 60 rows
Threshold Bit Score: 177.322
Threshold Setting Gi: 166208513
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1S8F_A    11 KVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIgVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFS 90  dog
P32253     6 KLVIVGDGGVGKSALTIQLTQNQFIAEYDPTI-ENSYRKQVNIDEEVYMLDILDTAGQEEYSAMRDQYIRSGRGFLIVYS 84  Dictyostelium disco...
EPB89605  12 KLVMVGGGGVGKSALTIQFIQSHFVDEYDPTI-EDSYRKQCVIDSETALLDVLDTAGQEEYSAMREQYMRNGEGFLLVYS 90  Mucor circinelloide...
P08647    10 KLVVVGDGGVGKSALTIQLIQSHFVDEYDPTI-EDSYRKKCEIDGEGALLDVLDTAGQEEYSAMREQYMRTGEGFLLVYN 88  Schizosaccharomyces...
P22126    10 KLVVVGGGGVGKSCLTIQLIQGHFLDEYDPTI-EDSYRKQCTIDNEVALLDILDTAGQEEYSAMREQYMRTGEGFLLVFA 88  Neurospora crassa O...
2FN4_A    11 KLVVVGGGGVGKSALTIQFIQSYFVSDYDPTI-EDSYTKICSVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFA 89  human
P04388     7 KLVVVGGGGVGKSAITIQFIQSYFVTDYDPTI-EDSYTKQCNIDDVPAKLDILDTAGQEEFSAMREQYMRSGEGFLLVFA 85  fruit fly
P01120    12 KLVVVGGGGVGKSALTIQLTQSHFVDEYDPTI-EDSYRKQVVIDDEVSILDILDTAGQEEYSAMREQYMRNGEGFLLVYS 90  Saccharomyces cerev...
P32254     5 KLVLVGPGGVGKSCLTIQFIAQKFVDEYDPTL-EDSYRKQTTVDGEECLLDIYDTAGQEDFSAVRDQYMRTGEGFLCVYS 83  Dictyostelium disco...
1ZC3_A     8 KVIMVGSGGVGKSALTLQFMYDEFVEDYEPTK-ADSYRKKVVLDGEEVQIDILDTAGLEDYAAIRDNYFRSGEGFLCVFS 86  human
1S8F_A    91 VDDSQSFQNLSNWKKEFIYYADvkepEsFPFVILGNKIDIS--ERQVSTEEAQAWCRDNGdYPYFETSAKDATNVAAAFE 168 dog
P32253    85 IISRASFEAVTTFREQILRVKDl--sT-YPIVIIGNKADLPdkDRKVPPMEGKELAKSFG-APFLETSAKSRVNVEEAFF 160 Dictyostelium disco...
EPB89605  91 ITSRLSFEEITTFYQQICRVKDr---DyFPMVLVGNKCDLEg-DRQVSSQEGRDLAKNFG-CQFIETSAKQRINVDEAFF 165 Mucor circinelloide...
P08647    89 ITSRSSFDEISTFYQQILRVKDk--dT-FPVVLVANKCDLEa-ERVVSRAEGEQLAKSMH-CLYVETSAKLRLNVEEAFY 163 Schizosaccharomyces...
P22126    89 INSRESFEEIRIYQQQILRVKDr--dS-FPMIIVGNKYDLRg-ERVVSEQEGQALAAEFG-TKYIETSAKTQHNVENAFY 163 Neurospora crassa O...
2FN4_A    90 INDRQSFNEVGKLFTQILRVKDr--dD-FPVVLVGNKADLEs-QRQVPRSEASAFGASHH-VAYFEASAKLRLNVDEAFE 164 human
P04388    86 LNDHSSFDEIPKFQRQILRVKDr--dE-FPMLMVGNKCDLKh-QQQVSLEEAQNTSRNLM-IPYIECSAKLRVNVDQAFH 160 fruit fly
P01120    91 ITSKSSLDELMTYYQQILRVKDt--dY-VPIVVVGNKSDLEn-EKQVSYQDGLNMAKQMN-APFLETSAKQAINVEEAFY 165 Saccharomyces cerev...
P32254    84 ITYLQSFKEIHRLHNHLLKVKDl--dS-VPFVLVGNKCDLNe-YREVSTAEGEELAKKLN-CKFLETSAKERINVSESFY 158 Dictyostelium disco...
1ZC3_A    87 ITEMESFAATADFREQILRVKEd---EnVPFLLVGNKSDLEd-KRQVSVEEAKNRAEQWN-VNYVETSAKTRANVDKVFF 161 human
1S8F_A   169 EAVRRVLA 176 dog
P32253   161 TLVREIKR 168 Dictyostelium discoideum
EPB89605 166 EVVRDIRr 173 Mucor circinelloides f. circinelloides 1006PhL
P08647   164 SLVRTIRR 171 Schizosaccharomyces pombe 972h-
P22126   164 DLVREIRK 171 Neurospora crassa OR74A
2FN4_A   165 QLVRAVRK 172 human
P04388   161 ELVRIVRK 168 fruit fly
P01120   166 TLARLVRD 173 Saccharomyces cerevisiae S288C
P32254   159 ELVREVKK 166 Dictyostelium discoideum
1ZC3_A   162 DLMREIRA 169 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap