1JWY,1OE9,4A7F


Conserved Protein Domain Family
Myosin_head

?
pfam00063: Myosin_head 
Click on image for an interactive view with Cn3D
Myosin head (motor domain)
Statistics
?
PSSM-Id: 365845
View PSSM: pfam00063
Aligned: 19 rows
Threshold Bit Score: 974.059
Threshold Setting Gi: 353526351
Created: 13-Mar-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1JWY_A   99 VEDMSELSYLNEPAVFHNLRVRY-N-QDLIYTYSGLFLVAVNPFKRIP-IYTQEMVDIFKGRRRNEVAPHIFAISDVAYR 175  Dictyostelium disco...
P22467   14 VEDLIMLTEVSESSLHENLKIRY-K-EGLIYTSIGPVLVSMNPYKQLG-IYGNDQINLYKGKHEFEIPPHIYSIADKAYR 90   Dictyostelium disco...
P34092   11 TDDLVMLPKVSEDEICENLKKRY-M-NDFIYTNIGPVLISVNPFRNLN-NSGPDFIEAYRGKHAQEVPPHVYQLAESAYR 87   Dictyostelium disco...
P34109    9 VDDMVMLSKIANDSILDNLKKRY-G-GDVIYTYIGNVLISVNPFKQIKnLYSERNLLEYRGKFRYELPPHAYAVADDMYR 86   Dictyostelium disco...
Q03479   10 VPDFVLLNQITENAFIENLTMRH-K-SDNIYTYIGDVVISTNPFKNLN-IYKESDIKAYNGRYKYEMPPHIYALANDAYR 86   Dictyostelium disco...
P10568   10 VEDLVLLEPLEQESLIRNLQLRY-E-KKEIYTYIGNVLVSVNPYQQLP-IYDLEFVAKYRDYTFYELKPHIYALANMAYQ 86   cattle
Q02440   71 ENDLTALSYLHEPAVLHNLKVRF-IdSKLIYTYCGIVLVAINPYEQLP-IYGEDIINAYSGQNMGDMDPHIFAVAEEAYK 148  chicken
P32492   73 TDDLTTLSYLNEPAVLHAIKKRY-M-NGQIYTYSGIVLIAANPFDKVDhLYSREMIQNYSSKRKDELEPHLFAIAEEAYR 150  Saccharomyces cerev...
P19524   72 TEDLTSLSYLNEPAVLHAIKQRY-S-QLNIYTYSGIVLIATNPFDRVDqLYTQDMIQAYAGKRRGELEPHLFAIAEEAYR 149  Saccharomyces cerev...
1OE9_A   71 eNDLTALSYLHEPAVLHNLKVRFiD-SKLIYTYCGIVLVAINPYEQLP-IYGEDIINAYSGQNMGDMDPHIFAVAEEAYK 148  chicken
1JWY_A  176 SMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQa-----nGSGVLEQQILQANPILEAFGNAKTTRNNNSSRF 250  Dictyostelium disco...
P22467   91 ALRSEGENQCIIISGESGAGKTEASKYIMQYIASITGSST-------EVERVKKTILESNPLLEAFGNAKTLRNNNSSRF 163  Dictyostelium disco...
P34092   88 AMKNDQENQCVIISGESGAGKTEAAKLIMGYVSAISGSTE-------KVEYVKHVILESNPLLEAFGNAKTLRNNNSSRF 160  Dictyostelium disco...
P34109   87 SMYAEGQSQCVIISGESGAGKTEAAKLIMQYIAAVSGKGAd-----vS--RVKDVILESNPLLEAFGNAKTLRNNNSSRF 159  Dictyostelium disco...
Q03479   87 SMRQSQENQCVIISGESGAGKTEASKKIMQFLTFVSSNQSp------NGERISKMLLDSNPLLEAFGNAKTLRNDNSSRF 160  Dictyostelium disco...
P10568   87 SLRDRDRDQCILITGESGAGKTEASKLVMSYVAAVCGKGEq-----vN--SVKEQLLQSNPVLEAFGNAKTIRNNNSSRF 159  cattle
Q02440  149 QMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSAS--------EANVEEKVLASNPIMESIGNAKTTRNDNSSRF 220  chicken
P32492  151 FMVHEKANQTVVVSGESGAGKTVSAKYIMRYFASVQESNNreg--evEMSQIESQILATNPIMEAFGNAKTTRNDNSSRF 228  Saccharomyces cerev...
P19524  150 LMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEEENSatvqhqvEMSETEQKILATNPIMEAFGNAKTTRNDNSSRF 229  Saccharomyces cerev...
1OE9_A  149 QMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSASe-----aN---VEEKVLASNPIMESIGNAKTTRNDNSSRF 220  chicken
1JWY_A  251 GKFIEIQFNSAGFISGASIQSYLLEKSRVVFQSETERNYHIFYQLLAGATAEEKKALHLA-GPESFNYLNQSG---CVDI 326  Dictyostelium disco...
P22467  164 GKYMEIQFNLGGDPEGGKITNYLLEKSRVINQTQGERNFHIFYQLLKGSSEEEKKTYNLL-SPDQYHYLTRNAsngCFTA 242  Dictyostelium disco...
P34092  161 GKYFEIQFDKAGDPVGGKIYNYLLEKSRVVYQNPGERNFHIFYQLLAGASAQEKRDYVLS-SPESYYYLNQSQ---CYTV 236  Dictyostelium disco...
P34109  160 GKYMEVQFNGIGDPEGGRVTNYLLEKSRVVYQTKGERNFHIFYQLLSGANQQLKSELRLDt-PDKFNYLSASG---CYTV 235  Dictyostelium disco...
Q03479  161 GKYMEMQFNAVGSPIGGKITNYLLEKSRVVGRTQGERSFHIFYQMLKGLSQSKLNELGLTpNAPAYEYLKKSG---CFDV 237  Dictyostelium disco...
P10568  160 GKYMDIEFDFKGFPLGGVITNYLLEKSRVVKQLEGERNFHIFYQLLAGADAQLLKALKLErDTGGYAYLNPD----TSRV 235  cattle
Q02440  221 GKYIEIGFDKRYRIIGANMRTYLLEKSRVVFQAEEERNYHIFYQLCASAALPEFKTLRLG-NANYFHYTKQGG---SPVI 296  chicken
P32492  229 GKYLQILFDENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLS-SPKDYHYTNQGG---QPNI 304  Saccharomyces cerev...
P19524  230 GKYLEILFDKDTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLT-DASDYFYMNQGG---DTKI 305  Saccharomyces cerev...
1OE9_A  221 GKYIEIGFDKRYRIIGANMRTYLLEKSRVVFQAEEERNYHIFYQLCASAALPEFKTLRLG-NANYFHYTKQGG---SPVI 296  chicken
1JWY_A  327 KGVSDSEEFKITRQAMDIVGFSQEEQMSIFKIIAGILHLGNIKFEKGA---GEgA----VLKDKTA-LNAASTVFGVNPS 398  Dictyostelium disco...
P22467  243 DGIDDQIGFKQTKNAMKVVGIDEPLQKEIFATLSAILLLGNLSFNKSAs--GNgS----VISDKKL-ANTIASLMGVDAI 315  Dictyostelium disco...
P34092  237 DGINDVSDYAEVRQAMDTIGLTAQEQSDIIRIVACVLHIGNIYFIEDDk--GNaA----IYDPNA--LELAASMLCIDSA 308  Dictyostelium disco...
P34109  236 DGVDDSGEFQDVCKAMKVIGLTDSEQKEVFRLVAAILYLGNVGFKNNAk--DEaA----IDQQSKKaLENFAFLMQTDVS 309  Dictyostelium disco...
Q03479  238 STIDDSGEFKIIVKAMETLGLKESDQNSIWRILAAILHIGNITFAEAAe--QRtGtttvKVSDTKS-LAAAASCLKTDQQ 314  Dictyostelium disco...
P10568  236 DGMDDDANFKVLQSAMTVIGFSDEEIRQVLEVAALVLKLGNVELINEFqanGVpA----SGIRDGRgVQEIGELVGLNSV 311  cattle
Q02440  297 DGIDDAKEMVNTRQACTLLGISDSYQMGIFRILAGILHLGNVEFASRDs--DScA----IPPKHDP-LTIFCDLMGVDYE 369  chicken
P32492  305 AGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRn--DA-S----LSSEEQN-LQIACELLGIDPF 376  Saccharomyces cerev...
P19524  306 NGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRn--DA-S----LSADEPN-LKLACELLGIDAY 377  Saccharomyces cerev...
1OE9_A  297 DGIDDAKEMVNTRQACTLLGISDSYQMGIFRILAGILHLGNVEFASRDs--DScA----IPPKHDP-LTIFCDLMGVDYE 369  chicken
1JWY_A  399 VLEKALMEPRILAG--------RDLVAQHLNVEKSSSSRDALVKALYGRLFLWLVKKINNVLCQER------KAYFIGVL 464  Dictyostelium disco...
P22467  316 VLESSLVSRQISTGqg----arISTYSVPQTVEQAMYARDAFAKATYSKLFDFIVRKINQSIEVKT------IGKVIGVL 385  Dictyostelium disco...
P34092  309 TLQNAILFRVINTGgaggagnrRSTYNVPQNVEQANGTRDALARTIYDRMFSWLVERVNQSLSYYKs----pYQNVIGIL 384  Dictyostelium disco...
P34109  310 SCEKALCFRTISTGtqgr-sarVSTYACPQNSEGAYYSRDALAKALYSRLFDWIVGRVNSALGYKQn----sQSLMIGIL 384  Dictyostelium disco...
Q03479  315 SLSIALCYRSISTGvg----krCSVISVPMDCNQAAYSRDALAKALYERLFNWLVSKINTIINCTTe-----KGPVIGIL 385  Dictyostelium disco...
P10568  312 ELERALCSRTMETA--------KEKVVTTLNVIQAQYARDALAKNIYSRLFNWLVNRINESIKVGTg----eKRKVMGVL 379  cattle
Q02440  370 EMAHWLCHRKLATA--------TETYIKPISKLHAINARDALAKHIYANLFNWIVDHVNKALHSTVk-----QHSFIGVL 436  chicken
P32492  377 NFAKWIVKKQIVTR--------SEKIVTNLNYNQALIARDSVAKFIYSTLFDWLVDNINKTLYDPEldqqdhVFSFIGIL 448  Saccharomyces cerev...
P19524  378 NFAKWVTKKQIITR--------SEKIVSNLNYSQALVAKDSVAKFIYSALFDWLVENINTVLCNPAvn--dqISSFIGVL 447  Saccharomyces cerev...
1OE9_A  370 EMAHWLCHRKLATA--------TETYIKPISKLHAINARDALAKHIYANLFNWIVDHVNKALHSTVk-----QHSFIGVL 436  chicken
1JWY_A  465 DISGFEIFKVNSFEQLCINYTNEKLQQFFNHHMFKLEQEEYLKEKINWTFIDFglDSQATIDLIDGrqpPGILALLDEQS 544  Dictyostelium disco...
P22467  386 DIYGFEIFENNSFEQFCINYVNETLQQIFIDLTLKTEQEEYVQEGITWIPVQYi-NNKACVDLIEKk-pIGILSLLDEEC 463  Dictyostelium disco...
P34092  385 DIFGFEIFEKNGFEQFCINFVNEKLQQFFIELTLKAEQEEYVREGIKWEPIKYf-NNQIVCDLIEGkspPGIFSLLDDIC 463  Dictyostelium disco...
P34109  385 DIYGFEIFEKNGFEQMVINYVNERLQQIFIELTLKTEQEEYFNEGIQWEQIDYf-NNKICCDLIESkkpAGILTILDDVC 463  Dictyostelium disco...
Q03479  386 DIYGFEVFQNNSFEQLNINFCNEKLQQLFIELTLKSEQEEYVREGIEWKNIEYf-NNKPICELIEKk-pIGLISLLDEAC 463  Dictyostelium disco...
P10568  380 DIYGFEILEDNSFEQFVINYCNEKLQQVFIEMTLKEEQEEYKREGIPWVKVEYf-DNGIICNLIEHn-qRGILAMLDEEC 457  cattle
Q02440  437 DIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKEQIPWTLIDFy-DNQPCINLIEAk--MGVLDLLDEEC 513  chicken
P32492  449 DIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFs-DNQPCIDLIENk--LGILSLLDEES 525  Saccharomyces cerev...
P19524  448 DIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFn-DNQPCIDLIENk--LGILSLLDEES 524  Saccharomyces cerev...
1OE9_A  437 DIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKEQIPWTLIDFy-DNQPCINLIEAk--MGVLDLLDEEC 513  chicken
1JWY_A  545 VFPNA----TDNTLITKLHSHF-SkKNA---KYEEP-R----------FSKTEFGVTHYAGQVMYEIQDWLEKNKDPLQQ 605  Dictyostelium disco...
P22467  464 LFPEG----NDQTMIDKLNKHF-S-NHT---HYSKV-Er---------QKNSQFIINHYAGKVFYNIDGFLDKNRDTLFN 524  Dictyostelium disco...
P34092  464 STLHAqstgTDQKFLEKMAGIY-D-GHL---HWr--------------GMTGAFAIKHYAGEVTYEAEGFSDKNKDTLFF 524  Dictyostelium disco...
P34109  464 NFPKG----DDQKFLDRLKESF-S-SHA---HFQSAa-----------QSSSSFTIKHYAGDVEYCAEGFVDKNKDLLFN 523  Dictyostelium disco...
Q03479  464 LIAKS----TDQTFLDSICKQF-E-KNP---HLQSY-Vvsk----drsIGDTCFRLKHYAGDVTYDVRGFLDKNKDTLFG 529  Dictyostelium disco...
P10568  458 LRPGVv---SDSTFLAKLNQLF-S-KHS---HYESKvTqnaqrqydhsMGLSCFRICHYAGKVTYNVNSFIDKNNDLLFR 529  cattle
Q02440  514 KMPKG----SDDTWAQKLYNTHlN-KCA---LFEKP-R----------LSNKAFIIKHFADKVEYQCEGFLEKNKDTVYE 574  chicken
P32492  526 RLPSG----SDESWASKLYSAF-N-KPPsneVFSKP-R----------FGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSL 588  Saccharomyces cerev...
P19524  525 RLPAG----SDESWTQKLYQTL-D-KSPtnkVFSKP-R----------FGQTKFIVSHYALDVAYDVEGFIEKNRDTVSD 587  Saccharomyces cerev...
1OE9_A  514 KMPKG----SDDTWAQKLYNTHlN-KCA---LFEKP-R----------LSNKAFIIKHFADKVEYQCEGFLEKNKDTVYE 574  chicken
1JWY_A  606 DLELCFKDSSD-NVVTKLFNDPNI--------------A------------SRAKKGANF-ITVAAQYKEQLASLMATLE 657  Dictyostelium disco...
P22467  525 DLVTLATSSSC-SLLVEIFKYVPPlevdpeqekknrdkFskngfannaaktFIPTDKKRP-ITAGFQFKNQVTSLLKSLY 602  Dictyostelium disco...
P34092  525 DLIEAIQCSKM-PFLASLFNEDT-----------------------------GSLQKKRP-TTAGFKIKTSAGELMKALS 573  Dictyostelium disco...
P34109  524 DLVELAACTTS-KLIPQLFPEINC---------------------------EKDKRK--P-TTAGFKIKESIGALVKALS 572  Dictyostelium disco...
Q03479  530 DLISSMQSSSD-PLVQGLFPPt-----------------------------RPEDSKKRP-ETAGSQFRNAMNALITTLL 578  Dictyostelium disco...
P10568  530 DLSQAMWKARH-PLLRSLFPEg----------------------------dPKQASLKRP-PTAGAQFKSSVTTLMKNLY 579  cattle
Q02440  575 EQIKVLKSSKKfKLLPELFQDEEKaisptsa-tpsgrvPlsrtpvkpakarPGQTSKEHK-KTVGHQFRNSLHLLMETLN 652  chicken
P32492  589 GHLDVFKATTN-PIFKQILDNRELrs-----------dDapeeqntekkimIPARLSQKK-PTLGSMFKKSLGELMAIIN 655  Saccharomyces cerev...
P19524  588 GHLEVLKASTN-ETLINILEGLEKaakk-------leeAkkleleqagskkPGPIRTVNRkPTLGSMFKQSLIELMNTIN 659  Saccharomyces cerev...
1OE9_A  575 EQIKVLKSSKKfKLLPELFQDEEKaisptsa-tpsgrvPlsrtpvkpakarPGQTSKEHK-KTVGHQFRNSLHLLMETLN 652  chicken
1JWY_A  658 TTNPHFVRCIIPNNKQLPAKLEDKVVLDQLRCNGVLEGIRITRKGFPNRIIYADFVKRYYLLAPNV---------PRDAE 728  Dictyostelium disco...
P22467  603 SCSPHYVRCIKPNSNMRALEWDQSKCAEQVAYLGLFENLLVRRAGYCYRQTFSKFMRRYYMIGKSTw--------PKWSG 674  Dictyostelium disco...
P34092  574 QCTPHYIRCIKPNETKKAKDWENSRVKHQVQYLGLLENVRVRRAGFAYRNTFDKVLKRYKKLSSKTwg-----iwGEWKG 648  Dictyostelium disco...
P34109  573 ACTPHYIRCIKPNGNKRANDFDTSLVMHQVKYLGLLENVRIRRAGYAYRQTYDKFFYRYRVCCKETw--------PNWTG 644  Dictyostelium disco...
Q03479  579 ACSPHYVRCIKSNDNKQAGVIDEDRVRHQVRYLGLLENVRVRRAGFAGRIEYTRFYNRYKMLCKKTw--------PSFNG 650  Dictyostelium disco...
P10568  580 SKNPNYIRCIKPNEHQQRGHFSFELVSVQAQYLGLLENVRVRRAGYAYRQAYGSFLERYRLLSRSTw--------PRWNG 651  cattle
Q02440  653 ATTPHYVRCIKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKd----------vLS 722  chicken
P32492  656 STNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYFLLTDYSlwsgilynpDLPKE 735  Saccharomyces cerev...
P19524  660 STNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYILIPHEqwdlifkkkETTEE 739  Saccharomyces cerev...
1OE9_A  653 ATTPHYVRCIKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQK----------DVLS 722  chicken
1JWY_A  729 DSQKATDAVLKHLNID---PEQYRFGITKIFFR 758  Dictyostelium discoideum
P22467  675 DAEKGVNLLMGELTQEiniKEEVQYGKTKIFIR 707  Dictyostelium discoideum
P34092  649 DAIEGCKTIFQDMNLE---AGQWQLGKTKVFIR 678  Dictyostelium discoideum
P34109  645 GFESGVETILKSMDLE---PKQYSKGKTKIFIR 674  Dictyostelium discoideum
Q03479  651 TAKQATELILQQHNID---KEEIRMGKTKVFIR 680  Dictyostelium discoideum
P10568  652 GDQEGVEKVLGELSMS---SEELAFGKTKIFIR 681  cattle
Q02440  723 DRKQTCKNVLEKLILD---KDKYQFGKTKIFFR 752  chicken
P32492  736 AIVNFCQSILDATISD---SAKYQIGNTKIFFK 765  Saccharomyces cerevisiae S288C
P19524  740 DIISVVKMILDATVKD---KSKYQIGNTKIFFK 769  Saccharomyces cerevisiae S288C
1OE9_A  723 DRKQTCKNVLEKLILD---KDKYQFGKTKIFFR 752  chicken
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap