Conserved Protein Domain Family
Filament

?
pfam00038: Filament 
Intermediate filament protein
Statistics
?
PSSM-Id: 333788
View PSSM: pfam00038
Aligned: 28 rows
Threshold Bit Score: 314.163
Threshold Setting Gi: 134085409
Created: 14-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P13648   29 QEKEDLQELNDRLAVYIDKVRSLELENAGLRLRITESEEV--V-SREVSgIKAAYEAELADARKTLDSVAKERARLQLEL 105  chicken
P19013  150 EEREQIKLLNNKFASFIDKVQFLEQQNKVLETKWNLLQQQttT-TSSKN-LEPLFETYLSVLRKQLDTLGNDKGRLQSEL 227  human
P35908  177 QEREQIKTLNNKFASFIDKVRFLEQQNQVLQTKWELLQQM--NvGTRPInLEPIFQGYIDSLKRYLDGLTAERTSQNSEL 254  human
P21807   93 NEKQELQELNDRFANFIEKVRFLEQQNAALRGELSQARGQ------EPArADQLCQQELRELRRELELLGRERDRVQVER 166  Norway rat
P14136   68 SERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAK------EPTkLADVYQAELRELRLRLDQLTANSARLEVER 141  human
P02542   98 NEKVELQELNDRFANYIEKVRFLEQQNALMVAEVNRLRGK------QPTrVAEMYEEELRELRRQVDALTGQRARVEVER 171  chicken
Q5M8K3  122 NEKAEMQELNDRFANFIDKVRFLEQQNKILVAELEQLKGK------GTSrIGDLYEEEMRELRRQLDQVTNAKDRVEVDR 195  tropical clawed frog
Q6GLH5   83 NEKEQLQGLNDRFVTYIEKVHQLEQQNKLLEAEVTLLRQK----HSEPSrLSQIYEQEIRELRSRLEEQEQEKDQAELDY 158  tropical clawed frog
P23565   93 NEKEQLQGLNDRFAVFIEKVHQLETQNRALEAELAALRQR----HAEPSrVGELFQRELRELRAQLEEASSARAQALLER 168  Norway rat
P12036   96 SEKEQLQALNDRFAGYIDKVRQLEAHNRSLEGEAAALRQQ----QAGRSaMGELYEREVREMRGAVLRLGAARGQLRLEQ 171  human
P13648  106 SKVREEHKELKARNAKKeadllaaqarlkdleallnskeaalstaLGEKRNLENEVRDLRaqvaklegalseakKQLQDE 185  chicken
P19013  228 KTMQDSVEDFKTKYEEE----------------------------INKRTAAENDFVVLK--------------KDVDAA 265  human
P35908  255 NNMQDLVEDYKKKYEDE----------------------------INKRTAAENDFVTLK--------------KDVDNA 292  human
P21807  167 DGLAEDLGALKQRLEEE----------------------------TRKREDAEHNLVLFR--------------KDVDDA 204  Norway rat
P14136  142 DNLAQDLATVRQKLQDE----------------------------TNLRLEAENNLAAYR--------------QEADEA 179  human
P02542  172 DNLLDNLQKLKQKLQEE----------------------------IQLKQEAENNLAAFR--------------ADVDAA 209  chicken
Q5M8K3  196 DNLADDLQRLREKLQDE----------------------------MIQKEEAEGNLQSFR--------------QDVDNA 233  tropical clawed frog
Q6GLH5  159 EHLGTCLQQLKMKLEQE----------------------------SGRREEAEDTLKNYR--------------KDLDQA 196  tropical clawed frog
P23565  169 DGLAEEVQRLRARCEEE----------------------------SRGREGAERALKAQQ--------------RDVDGA 206  Norway rat
P12036  172 EHLLEDIAHVRQRLDDE----------------------------ARQREEAEAAARALA--------------RFAQEA 209  human
P13648  186 MLRRVDAENRLQTLKEELEFQKNIYSEELRETKRRH-------ETRLVEIDN-GRQQEfeskLAEALQDLRRQHEDQIRH 257  chicken
P19013  266 YLNKVELEAKVDSLNDEINFLKVLYDAELSQMQTHVs-----dTSVVLSMDN-NRNLD----LDSIIAEVRAQYEEIAQR 335  human
P35908  293 YMIKVELQSKVDLLNQEIEFLKVLYDAEISQIHQSVt-----dTNVILSMDN-SRNLD----LDSIIAEVKAQYEEIAQR 362  human
P21807  205 TLSRLELERKIESLMDEIEFLKKLHEEELRDLQVSVes----qQVQQVEVEA-TVKPE----LTAALRDIRAQYENIAAK 275  Norway rat
P14136  180 TLARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLa-----rQQVHVELD--VAKPD----LTAALKEIRTQYEAMASS 248  human
P02542  210 TLARIDLERRIESLQEEIAFLKKVHEEEIRELQAQLq-----eQHIQVEMD--ISKPD----LTAALRDIRAQYESIAAK 278  chicken
Q5M8K3  234 SLARIDLERKVESLQEEIVFLKKLHDEEIRELQLQIq-----eSHIQVDMD--VSKPD----LTAALRDVRQQYENVAAK 302  tropical clawed frog
Q6GLH5  197 TLNRLQLEKKVESLLDEIAFLRKVHEEEIAELQASVq-----eAQTSVEMDV-VSKPD----LTAALKEIRMQYEVLSAR 266  tropical clawed frog
P23565  207 TLARLDLEKKVESLLDELAFVRQVHDEEVAELLATLqa----sSQAAAEVDVaVAKPD----LTSALREIRAQYESLAAK 278  Norway rat
P12036  210 EAARVDLQKKAQALQEECGYLRRHHQEEVGELLGQIqgsgaaqAQMQAETRD-ALKCD----VTSALREIRAQLEGHAVQ 284  human
P13648  258 YRDELEKTYGAKLENAKQSAERNSSMAGAAHEELQQTHIRIDSLSAELSQLQKQLAAKEAKLREVEEALSREREGGRRLL 337  chicken
P19013  336 SKAEAEALYQTKVQQLQISVDQHGDNLKNTKSEIAELNRMIQRLRAEIENIKKQCQTLQVSVADAEQRGENALKDAHSKR 415  human
P35908  363 SKEEAEALYHSKYEELQVTVGRHGDSLKEIKIEISELNRVIQRLQGEIAHVKKQCKNVQDAIADAEQRGEHALKDARNKL 442  human
P21807  276 NLQEAEEWYKSKYADLSDAANRNHEALRQAKQEMNESRRQIQSLTCEVDGLRGTNEALLRQLRELEEQFALEAGGYQAGA 355  Norway rat
P14136  249 NMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVREAASYQEAL 328  human
P02542  279 NIAEAEEWYKSKVSDLTQAANKNNDALRQAKQEMLEYRHQIQSYTCEIDALKGTNDSLMRQMREMEERFAGEAGGYQDTI 358  chicken
Q5M8K3  303 NLSDAEDWYKSKFADLSEAANRNNDALRQAKQDANDYRRQIQTLTCEIDAMKGSNESYERQMREMEENFAGEAANYQDTI 382  tropical clawed frog
Q6GLH5  267 NQQSSEEWYQAKIANVSLEASRNNDSVRQAKEEISEYRRQLQARTLEIDALRSANESLERQLQESEDRNNEEISHLQDTI 346  tropical clawed frog
P23565  279 NLQSAEEWYKSKFANLNEQAARSTEAIRASREEIHEYRRQLQARTIEIEGLRGANESLERQILELEERHSAEVAGYQDSI 358  Norway rat
P12036  285 STLQSEEWFRVRLDRLSEAAKVNTDAMRSAQEEITEYRRQLQARTTELEALKSTKDSLERQRSELEDRHQADIASYQEAI 364  human
P13648  338 AEKEREMAEMRARMQQQLDEYQELLDIKLALDMEINAYRKLLEGEEER 385  chicken
P19013  416 VELEAALQQAKEELARMLREYQELMSVKLALDIEIATYRKLLEGEEYR 463  human
P35908  443 NDLEEALQQAKEDLARLLRDYQELMNVKLALDVEIATYRKLLEGEECR 490  human
P21807  356 ARLEEELRQLKEEMARHLREYQELLNVKMALDIEIATYRKLLEGEESR 403  Norway rat
P14136  329 ARLEEEGQSLKDEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENR 376  human
P02542  359 ARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEENR 406  chicken
Q5M8K3  383 QRLQEEIHNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESR 430  tropical clawed frog
Q6GLH5  347 GQLDNALRTTKEEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETR 394  tropical clawed frog
P23565  359 GQLESDLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETR 406  Norway rat
P12036  365 QQLDAELRNTKWEMAAQLREYQDLLNVKMALDIEIAAYRKLLEGEECR 412  human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap