2A5D,1MOZ,3DOE,1M2O,2GAO,1FZQ


Conserved Protein Domain Family
Arf

?
pfam00025: Arf 
Click on image for an interactive view with Cn3D
ADP-ribosylation factor family
Pfam combines a number of different Prosite families together
Statistics
?
PSSM-Id: 333776
View PSSM: pfam00025
Aligned: 26 rows
Threshold Bit Score: 230.572
Threshold Setting Gi: 729139
Created: 13-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2A5D_A   1 MGKVLSKIFG-NKEMRILMLGLDAAGKTTILYKLKLGQSVT---TIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRH 76  pig
Q01475   7 FYDALAMLGLvNKHAKMLFLGLDNAGKTTLLHMLKNDRLAV---MQPTLHPTSEELAIGNVRFTTFDLGGHQQARRLWRD 83  Schizosaccharomyces p...
P20606  10 FRDVLASLGLwNKHGKLLFLGLDNAGKTTLLHMLKNDRLAT---LQPTWHPTSEELAIGNIKFTTFDLGGHIQARRLWKD 86  Saccharomyces cerevis...
P36536  12 FSSVLQFLGLyKKSGKLVFLGLDNAGKTTLLQMLKDDRLGQ---HVPTLHPTSEELTIAGMTFTTFDLGGHEQARRVWKN 88  house mouse
P39110   3 LLSIIRKQKLrDKEIRCLILGLDNSGKSTIVNKLLPKDEQNndgIMPTVGFQIHSLMIKDVTISLWDIGGQRTLRPFWDN 82  Saccharomyces cerevis...
P36404   3 LLTILKKMKQkERELRLLMLGLDNAGKTTILKKFNGEDIDT---ISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRN 79  human
Q06849   3 FLTVLKKMRQkEREMRILLLGLDNAGKTTILKRFNGEPIDT---ISPTLGFNIKTLEHNGYTLNMWDVGGQKSLRSYWRN 79  fruit fly
Q01474   7 FYGILASLGLwQKEAKILFLGLDNAGKTTLLHMLKDERLVQ---HQPTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKD 83  thale cress
3DOE_A   3 LLTILKKMKQkERELRLLMLGLDNAGKTTILKKFNGEDIDT---ISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRN 79  human
1M2O_B  10 FRDVLASLGLwNKHGKLLFLGLDNAGKTTLLHMLKNDRLAT---LQPTWHPTSEELAIGNIKFTTFDLGGHIQARRLWKD 86  Saccharomyces cerevis...
2A5D_A  77 YYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMR---DAIILIFANKQDLPDAMKPHEIQEKLGLTR-------IR- 145 pig
Q01475  84 YFPEVNGIVYLVDCCDFERLSESKAELDALLAMEELA---RVPFLILGNKIDAPGAISEDELKAALGLYQttg--kgVSk 158 Schizosaccharomyces p...
P20606  87 YFPEVNGIVFLVDAADPERFDEARVELDALFNIAELK---DVPFVILGNKIDAPNAVSEAELRSALGLLNttg-sqrIEg 162 Saccharomyces cerevis...
P36536  89 YLPAINGIVFLVDCADHSRLMESKVELNALMTDETIS---NVPILILGNKIDRTDAISEEKLREIKGLYGqttgkgnVTl 165 house mouse
P39110  83 YFDKTQAMIWCIDVSLSMRFDETLQELKELINRDENRigyECAVIVVLNKIDLVEDKSELHRRCLLVESE-------LKc 155 Saccharomyces cerevis...
P36404  80 YFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLA---GATLLIFANKQDLPGALSSNAIREVLELDS-------IR- 148 human
Q06849  80 YFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLA---GATLLVLCNKQDLPGALSSNEIKEILHLED-------IT- 148 fruit fly
Q01474  84 YYAKVDAVVYLVDAYDKERFAESKRELDALLSDEALA---TVPFLILGNKIDIPYAASEDELRYHLGLTNfttgkgkVTl 160 thale cress
3DOE_A  80 YFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLA---GATLLIFANKQDLPGALSSNAIREVLELDS-------IR- 148 human
1M2O_B  87 YFPEVNGIVFLVDAADPERFDEARVELDALFNIAELK---DVPFVILGNKIDAPNAVSEAELRSALGLLN-------TTg 156 Saccharomyces cerevis...
2A5D_A 146 ------DRNWYVQPSCATSGDGLYEGLTWLTSN 172 pig
Q01475 159 pv--pgIRPIEVFMCSVVLRQGYGEGFKWLAQY 189 Schizosaccharomyces pombe 972h-
P20606 163 ------QRPVEVFMCSVVMRNGYLEAFQWLSQY 189 Saccharomyces cerevisiae S288c
P36536 166 ke--lnARPMEVFMCSVLKRQGYGEGFRWLSQY 196 house mouse
P39110 156 lf--kpDIRIELVKCSGVTGEGIDNLRDRLVES 186 Saccharomyces cerevisiae S288c
P36404 149 ------SHHWCIQGCSAVTGENLLPGIDWLLDD 175 human
Q06849 149 ------THHWLVAGVSAVTGEKLLSSMDWLIAD 175 fruit fly
Q01474 161 gd--sgVRPLEVFMCSIVRKMGYGEGFKWLSQY 191 thale cress
3DOE_A 149 ------SHHWCIQGCSAVTGENLLPGIDWLLDD 175 human
1M2O_B 157 sqriegQRPVEVFMCSVVMRNGYLEAFQWLSQY 189 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap