5ADX


Conserved Protein Domain Family
Actin

?
pfam00022: Actin 
Actin
Statistics
?
PSSM-Id: 394979
View PSSM: pfam00022
Aligned: 25 rows
Threshold Bit Score: 382.808
Threshold Setting Gi: 75035327
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5ADX_A         3 NQPVVIDNGSGVIKAGFAGDQIPK----------YCFPNYVG-----RPKHVRVMAgal---------------egDIFI 52 
Q54HF0         6 VQAIVIDNGSSVCKAGFGGDDAPR----------TAFPSIVG-----RPRCTGFIVdmdkkdsyfckknscfmgqkDLYI 70  Dictyostelium d...
Q59QT2         7 NQPVVIDNGSGNLKAGFAGEDKPK----------SYASAIIG-----RPKYQKIMAagstsll------seqqshdQLFI 65  Candida albicans
XP_017263357   9 NQPVVIDNGSGVIKAGFAGDQIPK----------YCFPNYVG-----RPKHVRVMAgal---------------egDLFI 58  mangrove rivulus
Q4QF49        25 TNAAVLDMGSHTTRLGFAGDTVPR----------MRQRTCVV-----KGKGTFSDAcd-----------------vLDHV 72  Leishmania major
Q5NBI2         5 SGVVVLDNGGGLLKAGFGGDMNPT----------AVVPNCMA-----KPPGSK-----------------------KWLV 46  Japanese rice
Q4W9M3        22 EKTFIIDNGAYTLKAGYAPGFPPPedlgqalsacSTIPNAIA-----KTRGN------------------------RIYI 72  Aspergillus fum...
Q4Q187         8 IQSVVVDVGTRNTRVGFSGEEAPR----------TMLRSCVGlpgtrRPRPTLLQH--------------------PFDI 57  Leishmania major
Q4D5V4         8 VPVVILDTGSHCLRAGYADEQGPR----------LDIPALVG-----HPRNRGVAMaag---------------mnEYEI 57  Trypanosoma cruzi
Q386C6         8 APVVILDGGSHHLRAGYASDGAPR----------LDIPALVG-----HPRNRGVAVaag---------------mnEYEI 57  Trypanosoma brucei
5ADX_A        53 GPK---AEEh--RGLLSIRYPM-EHGIVKDWNDMERIWQYVYsKEQ-LQTF--------SEEHPVLLTEAPLNPRKNRER 117
Q54HF0        71 GDE---AQSk--RGILNVKYPI-ERGIITNWNDMEEIWYHTF-YNE-LHVA--------PEEHPVLLTEPPLNPKANREK 134 Dictyostelium d...
Q59QT2        66 GNS---AQDn--RGLLKLSYPI-EHGIVNNWSDMEKLWYHTY-TQD-LKTQ--------SEDHPLLITEAPLNPRSNRNK 129 Candida albicans
XP_017263357  59 GPK---AEEh--RGLLSVRYPM-EHGIVKDWNDMERIWQYVY-SKEqLQTF--------SEEHPVLLTEAPLNPSKNREK 123 mangrove rivulus
Q4QF49        73 DDPa-aATT------------VlENGVIVDWEGYEELLSRVA-RILdLENV--------ENSTPLLVTEKALVPTHQRQK 130 Leishmania major
Q5NBI2        47 ADQl-qAQDv-dVTGMTLRRPI-DRGYLINQEVQREVWERVI-RNL-LQVD--------PNNSSLLLVEPQFNPPALQHA 113 Japanese rice
Q4W9M3        73 GAQlnsQVTd--WNEMVFRRPV-EKGYIVNWEAQKEIWDNAF-FDE-KTVRskdlriesPEDTTLVLTEAPNALPTLQKN 147 Aspergillus fum...
Q4Q187        58 ATG---DAAyndGGLLSLTYPV-RAGHVCDYDALEKLLFYAL-VEE-ARVT--------PDTSPFLFLVPADQTRLDRER 123 Leishmania major
Q4D5V4        58 GEE---ALVk--RGMLTVGSPI-ENGLVVNWEHMEKLWSHVM-FSE-MRVT--------PESHCFVVPQPVNTPAAQKEK 121 Trypanosoma cruzi
Q386C6        58 GDV---ALAk--RGMLTVSSPI-ESGRVVSWENMEKLWGHVM-YSE-LRVR--------PESHCFIVPQSVNTPASQKEK 121 Trypanosoma brucei
5ADX_A       118 AAEVFFETFNVPALFISMQAVLSLYATGRT------------------TGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDI 179
Q54HF0       135 MTQIMFETFKTPAIYVANQGVLSLYSTGLT------------------TGIVMNSGDGVSHTVPVYEGYILRQAILSLDL 196 Dictyostelium d...
Q59QT2       130 MCQILFENFNIPCIYISIQAVLSLYASGRT------------------TGVVIDSGDGVTHVVPVYEGFALPPSIKRMDI 191 Candida albicans
XP_017263357 124 AAEIFFETFNVPALFISMQAVLSLYATGRT------------------TGVVLDSGDGVTHVVPIYEGFAIPHSIMRVDI 185 mangrove rivulus
Q4QF49       131 IAEVLFETHRVVATSFALSPVLSLYASGLG------------------TGVAVELGHDQSHVAPVFQGLSLFHATHCLDV 192 Leishmania major
Q5NBI2       114 TDELVFEELGFKSLCVADAPSLVHLYEASRqpsl----------fraqCSLVVDCGFSFTHASPVLQNFTLNYAVRRMDL 183 Japanese rice
Q4W9M3       148 ADEIVMEEWGFGGYVRFVGPVLNAWNEVQSlfgdpigqdssspispkqCLLVVDSGYSHTTVTPVYKGQPIQRAIRRLDI 227 Aspergillus fum...
Q4Q187       124 LCELLFESFNIPLAGLLTNTAATLYSSGRT------------------RGLALDSGAGRTCVAAVEEGYTLAHSVRSSSL 185 Leishmania major
Q4D5V4       122 TLELMMETFHVHSLFLGTSQVLSLYGYGLT------------------TGLVLDSGKDRTMAVPVHEGYALGRHVTESEI 183 Trypanosoma cruzi
Q386C6       122 TLELMMETFHVHSLFLGASQVLSLYSYGLT------------------TGLVIDSGKDRTMAVPVHEGYALGRHVAESDV 183 Trypanosoma brucei
5ADX_A       180 AGRDVSRFLRLYLRK-----E-G-YDFHSSSEFEIVKAIKERACYLSINPQK-----------------DETLET----- 230
Q54HF0       197 AGRDLTDYMNELLTDr------G-YYFTTKGEKEIVRGIKEKLSYVALDFEAe---------------mQIASAS----- 249 Dictyostelium d...
Q59QT2       192 AGRDITESLAFNIRRm-----tG-VALQSSSELEIVRLIKEQNCFISKDPVRdekky--------gshySRNNPN----- 252 Candida albicans
XP_017263357 186 AGRDVSRYLRLLLRK-----E-G-YNFNTSAEFEVVRTIKERACYLSLNPQK-----------------DETLET----- 236 mangrove rivulus
Q4QF49       193 GGADLTRHFTSLMSGvatthVsvlgSMTPTQRESMWEYIKERHCTVAEDAQA-----------------FSEISRvgigm 255 Leishmania major
Q5NBI2       184 GGKALTNYLKELISYr---------SLNVMDETLLIDDAKEKLCFVSLDVPGdl--------------rLARLSSn---- 236 Japanese rice
Q4W9M3       228 GGKHLTNYLKEMVSM-----R----QYNMVDETYIMNEVKEAVCFVSNNFAGdl--------------eQTWQGNrkrgl 284 Aspergillus fum...
Q4Q187       186 AGEALTDELFAALRAg------G-YPLSTAADRGVVEAAKEALCRV-----------------------SADAKDeearq 235 Leishmania major
Q4D5V4       184 AGETLTNYLASLLRQe------G-YSFGTPVEMQVLNKAKEELCYVRLNEFGvyspvhslgtlgnaaafDYNFSSsaq-- 254 Trypanosoma cruzi
Q386C6       184 AGEKLTEYFASLLRL-----E-G-YSFGTPMEMQVLNNAKEDLCYVKPPIFNmtgpsa-----------ffspsEfpgec 245 Trypanosoma brucei
5ADX_A       231 ---------------------EKAQ--------Y----YLPDG------------------------------------- 240
Q54HF0       250 ---------------------PALEk------sY----ELPDG------------------------------------- 261 Dictyostelium d...
Q59QT2       253 ---------------------NELMs------tY----KLPDG------------------------------------- 264 Candida albicans
XP_017263357 237 -----------------------EKa------qY----VLPDG------------------------------------- 246 mangrove rivulus
Q4QF49       256 g---------------spssgSPPGsphgeedrYreecVLPDGt------------------------------------ 284 Leishmania major
Q5NBI2       237 --------------------dNPFRc------sY----ILPDGitykkgfvkdldeacrysslpangesvrkdssdsdrs 286 Japanese rice
Q4W9M3       285 -----------------tdaaEGITv------dY----VLPDPntgkkgfmrphdplsna-------------kkrksil 324 Aspergillus fum...
Q4Q187       236 v---------------gthshPDPAd------gF----ILPDQ------------------------------------- 253 Leishmania major
Q4D5V4       255 ------------------rpgSSPVpat--eevF----FLPDG------------------------------------- 273 Trypanosoma cruzi
Q386C6       246 dydlslegapgegfedgredhSSDEr------vF----YLPDG------------------------------------- 278 Trypanosoma brucei
5ADX_A       241 ----------S--TIEIGPSRFRAPELLFRPDLIGEESE------------------------GIHEVLVFAIQKSDMDL 284
Q54HF0       262 ----------Q--VITIGNERFRCPEALFRPYT------------------------------GIHETIYNSIMKCDDDI 299 Dictyostelium d...
Q59QT2       265 ----------H--EIQLGVERFRATEILFNPQLIGHESP------------------------GIHELTSLAIAKTDLDL 308 Candida albicans
XP_017263357 247 ----------S--TLNIGPARFRAPELLFRPDLIGDESS------------------------GIHEVLAYAIQKSDMDL 290 mangrove rivulus
Q4QF49       285 ------------aLPISGAARFIPGECYFQPSLSPALQQlrdqstvvde----vllrttqtpvSIPELVVDAMKRCDHDL 348 Leishmania major
Q5NBI2       287 kfedkkkpelSqnEFVLTNERFLVPEMLFHPIDLGMNQA------------------------GLAECIVRAIQACHPHL 342 Japanese rice
Q4W9M3       325 sggnaealseD--VLILGNERFTVPEILFTPSDIGMKQA------------------------GIPDIILQSLSVLPTGL 378 Aspergillus fum...
Q4Q187       254 ----------E--RIFLLEHAYKVPEALFDSTYLTYTTAlsaerpttptgysqsnpivkktlsGWVGMLRDAADAAPRIL 321 Leishmania major
Q4D5V4       274 ----------N--AIPLAEHRHLTTEVLFNFGIMGEEyipksrymtel-----geifnpsfpmGISWLSFAAINNCQPAM 336 Trypanosoma cruzi
Q386C6       279 ----------N--AIPISTHRSLTTEALFDFGILGSQYVpksrymtelg-----eifqpsfpmGVSWLAFAAINNCQPVI 341 Trypanosoma brucei
5ADX_A       285 RRTLFSNIVLSGGSTLFKGFGDRLLSEVKKl----------------APKDV-----KIRISAPq---ERLYSTWIGGSI 340
Q54HF0       300 RKDLFGSVVLSGGSTMFPGIVDRMNKELTAl----------------APSTM-----KIKIIAPp---ERKYSVWIGGSI 355 Dictyostelium d...
Q59QT2       309 RSTLYQNIILSGGNTLLKNFGDRMLKELKDlqqplqedqkmsiwnknVQNDVyntkmKVKIYAPp---ERKYSTWIGGSI 385 Candida albicans
XP_017263357 291 RRTLFSTIVLCGGSTLIKGFGERLLTEVKKl----------------APKDV-----KIKISAPq---ERLYSTWIGGSI 346 mangrove rivulus
Q4QF49       349 LPTFASHIVVSGGASLLRGLTQRVESDVQTc---------------lASTGGihsvgSARVYADv---ERRDAAFVGGSI 410 Leishmania major
Q5NBI2       343 QPVLFERIILTGGSTLFPRFTERLEKELRPl----------------VPDDY-----QVKIIAQe---DPILGAWRGGSL 398 Japanese rice
Q4W9M3       379 HPSFLANVLVVGGNTLIPGFLERLESELRQi----------------ASAEC-----VVRVRRPh---DPIRSTWLGASR 434 Aspergillus fum...
Q4Q187       322 EQALYENVVLGGGSTLFPGTEQRVQREIAGi----------------APKGV-----RATCVAFp---ERGAAAWMGASI 377 Leishmania major
Q4D5V4       337 RPSLFAHIVLAGGNVSFPGTRERIEAEVTRly-------------reTHASE-----AVTPICVhdveCRIYSAWLGGSM 398 Trypanosoma cruzi
Q386C6       342 RAQLYASIVLSGGNVSFPGTRERIETEVTQly-------------reTHTSE-----AVTPIAVndipCRVYSAWVGGSM 403 Trypanosoma brucei
5ADX_A       341 LASLD-TFKKMWVSKKEYEEDGARSIHRKTF 370
Q54HF0       356 LASLS-SFQPRWISKEEYDESGPSIVHRKCF 385 Dictyostelium discoideum
Q59QT2       386 LAGLS-TFKKMWVTSEEYHEN-PDIVHVKCM 414 Candida albicans
XP_017263357 347 LASLD-TFKKMWVSKREYEEDRARAIHRKTF 376 mangrove rivulus
Q4QF49       411 WASLP-AAQALWVTKADYNEVGSMAVVRGGF 440 Leishmania major
Q5NBI2       399 LAHRP-DFESMCITKSEYEEMGSMRCRRRFF 428 Japanese rice
Q4W9M3       435 LAANRaELRKFAITRQEYQEYGSSWAGRKFS 465 Aspergillus fumigatus Af293
Q4Q187       378 WGCSS-VFPDTCLAKATYDEQGSSVVHLYTQ 407 Leishmania major
Q4D5V4       399 LARTS-MFPHLTVSRQEYEEQGYRVVHCKCQ 428 Trypanosoma cruzi
Q386C6       404 LAGTS-MFPHLAVSRQEYEEQGHRVVHCKCQ 433 Trypanosoma brucei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap